KEGG   Frankia sp. EAN1pec: Franean1_0773Help
Entry
Franean1_0773     CDS       T00608                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
fre  Frankia sp. EAN1pec
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:fre00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(901685..902863)
Genome map
AA seq 392 aa AA seqDB search
MPRSHPGRRATEPGRPLPTVTVRAPAKVNLHLGVGPRRPDGYHEVTTILQAVALYDDITA
TSVPPESLSGPEGAGPVFTDEDPIAVTVGVAGEGARPATSDDADGAGDGPGGSPGDTGAE
PSVSVVPTGKDNLAVRAAYLVAEAAGIRGEAVHLTLSKGIPVAAGMAGGSADAAAALLAC
DTLWGAGLDRETLVALAAKLGSDVPFPLTGGTALGTGRGEQLTDVLGRGEYHWVFALADG
GLSTPAVYGEFDRLSEGRLRTGPTPADAVLSALRSGDPAELGAALVNDLQPAALRLRPSL
RRVLESGLELGAIGAIVSGSGPTCAFLTRDAAASVSLAASLAGMGVARAVRRAHGPVAGA
RVIGPADPAGPGGEPGSSTAQSPPLSPSSSPA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
ttgcctcgatcgcatccgggtcgacgcgccaccgaacccggccgccccctgccgaccgtc
accgttcgcgctcccgccaaggtcaacctccacctcggggtgggcccacgccggcccgac
ggctaccacgaggtgacgacgatcctgcaggccgtcgcgctgtacgacgacatcaccgcg
acgtcggtccccccggagtcactctccgggcccgagggcgccggcccggtgttcaccgac
gaggacccgatcgcggtcacggtcggcgtcgccggcgagggcgcgcggccggcaacgtca
gacgacgcggacggcgctggcgacggcccgggtggttccccgggtgacaccggcgccgag
ccgtccgtctcggtggtgccgaccggtaaggacaacctggctgtccgcgccgcctacctg
gtcgccgaggccgccgggatccgcggcgaggccgtccacctgacgctgtcgaagggcatc
ccggtcgccgccgggatggccggcggcagcgccgacgcggccgcggccctgctcgcctgc
gacacgctgtggggcgccggcctcgaccgcgagacccttgtcgcgctggccgccaagctg
ggcagcgacgtcccgttcccgctcaccggtgggacggcgctgggcaccggccgcggtgag
cagctcaccgacgttctcgggcgcggcgagtaccactgggtgttcgcgctcgccgacggc
gggctgtcgacgcccgccgtctacggcgagttcgaccggctctccgagggcaggctgcgc
accgggcccacgcccgcggacgccgtcctgagcgccctgcgcagcggggacccggcggag
ctcggagccgccctggtcaacgacctgcagccggcggcgctgcggctgcgcccgtccctg
cggcgggtactggagagcgggctggagctgggcgcgatcggcgcgatcgtgagcggatcc
gggccgacctgcgctttcctcacccgcgacgcggcggcgagcgtctcgctcgccgcgagc
ctcgccggcatgggcgtcgcgcgcgccgtccgacgggcccacggcccggtcgccggagca
cgggtgatcggcccggcggacccggccggtccgggtggggagccgggcagctccacggcg
cagtccccgccgctctccccctcgtcgtcaccggcgtga

DBGET integrated database retrieval system