KEGG   Frankia sp. EAN1pec: Franean1_0823Help
Entry
Franean1_0823     CDS       T00608                                 

Definition
putative magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
fre  Frankia sp. EAN1pec
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:fre00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(962328..963839)
Genome map
AA seq 503 aa AA seqDB search
MADPPAPHSPSTPPTNPITVGATARKTTDAPGSGTPPTDITLADLRRSGHRQRSVRAELR
GNLLARMRADETRFPGIVGFDDTVLPQVERALLAGHDIVFLGERGQGKTRLIRTLVGLLD
EWSPAIAGCEINDHPYAPVCGRCRLLLAEVGERLPIAWRHRSERFGEKLATPDTSVGDLI
GDVDPVKVAEGRTLGDPETVHYGLVPRTNRGIFSINELPDLAERIQVSLLNVLEERDIQV
RGYMLRLPLDILLVASANPEDYTNRGRIITPLKDRFGAEVRTHYPLRLDDELRLIRQEAV
VSWADSPLGRPELPDHLIEVVARFTRAVRDAPQVDQRSGVSARLAVAAAETVAASAVRRA
ALTGEDTATARVVDLAAIVPAVRGKVEFDQLEEGREDEVLALLLRRAIAETFRAKLAGTD
LSGLQQRFERDGAVETGDLVPAAELLRRVGPVPGLAAILNRLDIDGAESPGLAAAALELA
MEGLHLNRRLAKEELPGRTVYGG
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
gtggcagatccgccggctccgcacagtccgtccacgcctccgacgaacccgatcaccgtc
ggcgcgacggcccggaagacgaccgacgcccccgggtccggaactccgccgaccgacatc
accctggctgacctgcgcagatcagggcaccggcagcgctcggtgcgcgccgagctgcgc
ggcaacctcctcgccaggatgcgggccgacgagacccgtttcccgggcatcgtcggtttc
gacgacaccgtcctgccgcaggtcgaacgagcgctgctggccgggcacgacatcgtcttc
ctcggcgagcgcgggcagggcaagacccgtctgatccgcacgctcgtcggcctgctcgac
gagtggtcgccggccatcgccggctgcgagatcaacgaccacccctacgcgccggtgtgc
ggccggtgccgcctgctgctcgccgaggtgggcgagcggctgcccatcgcctggcggcac
cgctcggagcgcttcggcgagaagctcgcgacccccgacaccagcgtcggcgacctgatc
ggcgacgtcgacccggtgaaggtcgccgagggccgcaccctcggcgacccggagaccgtc
cactacgggctggtcccgcggaccaaccgcggcatcttcagcatcaacgagctgcccgac
ctggccgagcgcatccaggtctcgctgctcaacgtgcttgaggagcgagacatccaggtc
cgcggctacatgctgcggctgccgctggacatcctgctggtcgcctcggcgaacccggag
gactacaccaaccgtggccggatcatcacgccgctgaaggaccgcttcggcgccgaggtc
cgcacgcactacccgctgcgcctggacgacgagctgcggctcatccggcaggaggccgtg
gtctcctgggccgactcgccgctgggccggcccgagctgcccgaccacctcatcgaggtg
gtcgcccggtttacccgggcagtgcgcgacgcgccgcaggtggaccaacgctcgggtgtg
tcggcccggctcgcggtggcggcggcggagacggtggccgcctcggccgtccgccgggcg
gcgctgaccggcgaggacaccgccaccgcgcgggtcgtcgacctggccgcgatcgtcccg
gcggtacggggcaaggtcgagttcgaccagctcgaggagggccgcgaggacgaggtcctg
gccctgctgctgcgccgcgcgatcgcggagaccttccgagcgaagctggccggcaccgac
ctctccggcctgcagcagcgcttcgagcgcgacggcgcggtcgagacgggcgatctcgtc
ccggcggccgagctgctgcgccgggtcggtcccgtcccaggcctggcggcgatcctcaac
cgcctcgacatcgacggcgcggagtcgccggggctggccgcggccgccctggagctggcg
atggagggcctgcacctcaaccgccggctcgccaaggaggaactgcccggccggacggtc
tacgggggctga

DBGET integrated database retrieval system