KEGG   Frankia sp. EAN1pec: Franean1_0893Help
Entry
Franean1_0893     CDS       T00608                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
fre  Frankia sp. EAN1pec
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Franean1_0893
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Franean1_0893
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Franean1_0893
Enzymes [BR:fre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Franean1_0893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
1041757..1043421
Genome map
AA seq 554 aa AA seqDB search
MTRDEYSPVPAPMRPGRRAVLLGGIGGLAAAVVGGCGGGSGPAPSPAPTLRAPTPIPGIR
DGVFSLGVASGDPLPDGVILWTRLAPEPMAGGGMPRRDVEVDWQVARDEKFADVVRAGTQ
LATTSFAHSVHVDVRGLEPGRDYYYRFRAGDVLSPVGRTRTAAAPGSPGGELSFALASCQ
DFQNGYWPAFDAIAGDRPDLVLHVGDYIYEYDPDSRYPDRRHTTPEKSGLDQLQTLADYR
NRYGQYKSDPALQAAHHVAPWVVAWDDHEVENNYAGLVDESGDTGPQHQDPQVFARQRAA
AYQAYYEHMPIRAELDPGSPDLRIYRRLTFGDLLTLNVMDTRQYRTPQPGSPPDGIGAIR
LGDDNTAGTMSGTAQEAWLVDGLRTSRSRWNVIAQQTMAAQLHGQLPGSEVLTNLDQNDG
YVPYRTRLLSAVRDTRVANPVLLAGDIHCAWVNDLRVDFDRPETPVIATEFVCTSISSGF
FLISEDFVRENNAQLNPHVRYFRGDLRGYTRVTVTPDEWRADMRVVETIAKRDAPASTDA
TWVVEAGRPGAQEA
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcgggacgaatactcacccgtgcccgcgcccatgcggccgggccggcgggcggtg
ctcctcggtgggatcggcggcctggccgcggcggtcgttggcggctgcggcggtggttcc
gggccggcgccgtcccccgcgccgaccctgcgcgcgccgacccccatcccggggatccgc
gacggggtcttctcactcggcgtggccagcggcgacccgctgcccgacggggtgatcctc
tggacgcggctggcgccggaaccgatggccggtgggggcatgcccaggcgcgacgtcgag
gtcgactggcaggtcgcccgggacgagaagttcgcggacgtcgtccgtgccggcacccag
ctcgccacgacgtccttcgcccattcggtccatgtggacgtccgcggcctggagcccggg
cgggactactactaccggttccgggcgggcgacgtcctcagcccggtcgggcggacccgt
accgcggccgcgccgggttcgcccggcggtgagctgtccttcgcgctcgcgagctgccag
gacttccagaacgggtactggcccgccttcgacgcgatcgccggcgaccgcccggacctc
gtcctgcacgtcggggactacatctacgagtacgaccccgacagcaggtaccccgaccgc
cggcacaccacccccgagaagtcggggctcgaccagctccagaccctcgccgactaccgc
aaccgctacgggcagtacaagtccgaccccgcgctgcaggccgcccaccacgtggccccg
tgggtcgtcgcgtgggacgaccacgaggtcgagaacaactacgccggcctggtcgacgag
agcggcgacaccggcccccagcaccaggacccgcaggtcttcgcccggcagcgggccgcc
gcctaccaggcgtactacgagcacatgccgatccgcgccgagctcgacccgggttcgccg
gacctgcggatctaccgccggctcaccttcggtgacctgctgacgctcaacgtgatggac
acccgccagtaccggaccccgcagcccgggtcaccgccggacgggatcggcgccatccgg
ctgggcgacgacaacaccgccgggaccatgtccggcaccgcccaggaggcctggctcgtc
gacggcctgcgcacctcccggtcgcgctggaacgtcatcgcccagcagacgatggccgcc
cagctgcacggccagctgcccggttccgaggtgctcaccaacctcgaccagaacgacggt
tacgtgccctaccggacgcgcctgctctcggccgtgcgtgacacccgggtcgccaacccg
gtgctgctcgccggggacatccactgcgcctgggtgaacgacctgcgggtcgacttcgac
cgcccggagactccggtgatcgcgaccgagttcgtctgtacgtccatcagctcgggcttc
ttcctcatcagcgaagatttcgtccgggagaacaacgcgcagctcaacccgcacgtgcgc
tatttccgcggtgacctccggggctacacccgcgtcaccgtgacacccgacgagtggcgc
gccgacatgcgggtcgtcgagacgatcgcgaagcgggacgcccccgcgtcgaccgacgcg
acctgggtcgtcgaggccgggaggcccggcgcgcaggaggcctga

DBGET integrated database retrieval system