KEGG   Frankia sp. EAN1pec: Franean1_1006Help
Entry
Franean1_1006     CDS       T00608                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
fre  Frankia sp. EAN1pec
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:fre01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:fre00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:fre00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
1186838..1187962
Genome map
AA seq 374 aa AA seqDB search
MTTMSSMPVSSDPAGSSAPERASRAWRGIIEEYRDRLPVTADTPVITLREGGTPLLHADH
LSELTGCDVHLKVEGANPTGSFKDRGMTVAISRAVGEGSQAVICASTGNTSASAAAYAAR
AGLTCAVLVPSGKIALGKLAQALVHGARLLQVEGSFDDCLRVARELADTFPVTLVNSVNP
HRLEGQKTAAFEIVEALGHAPDVHCLPVGNAGNITAYWRGYVEEDTRIRSGRPRMFGFQA
AGAAPIVRGEVVTSPQTIATAIRIGNPASWDFATDARDASGGLIDAVNDRQILAAYRLLA
RREGVFVEPSSAASVAGLLATYADGRLSPGQRVVCTVTGNGLKDPDWAISGAAKPETIPP
TVAGAARALGLQRS
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgatgtcgtcgatgccggtttcgagcgacccggccggcagcagtgcccccgag
cgcgcgtcgcgggcctggcgggggatcatcgaggagtaccgggaccggctgcccgtcacc
gccgacacaccggtgatcaccctgcgggagggcggcaccccgctgctgcacgcggaccat
ctgtccgagctgaccggatgtgatgttcatctcaaggtcgaaggtgccaaccccaccggc
tcgttcaaggaccgcggcatgacggtcgcgatcagccgggcggtgggagagggctcccag
gccgtcatctgcgcgtccaccggcaatacctcggcctcggccgcggcgtacgccgcccgc
gccgggctgacctgcgcggtgctggttcccagcggcaagatcgccctcggcaagctcgcg
caggccctggtgcacggcgcgcgcctgctccaggtggaggggtcgttcgacgactgcctc
cgggtcgcccgcgagctggccgacacgttcccggtcacgctggtgaactcggtcaacccg
caccgcctggaggggcagaagaccgccgccttcgagatcgtcgaggcgctcggccacgcg
cccgacgtgcactgcctgccggtcgggaacgcgggtaacatcaccgcctactggcgcggc
tacgtcgaggaggacacccggatccggtccggccggccgcggatgttcgggttccaggcg
gcgggcgcggcgccgatcgtgcggggcgaggtggtgacctcgccgcagaccatcgccacg
gccatccgcatcggcaacccggcctcctgggatttcgcgaccgacgcgcgggacgcctcc
ggcggtctgatcgacgcggtcaacgaccggcagatcctggccgcctaccggctgctggcg
cgccgcgagggcgtcttcgtcgagccgtccagtgccgccagcgtcgccgggctgctcgcc
acgtacgccgacggccggctgagcccgggccagcgggtcgtctgcaccgtcaccggcaac
gggctgaaggacccggactgggccatcagcggcgcggcgaagcccgagaccatcccgccg
accgtggccggcgccgccagggccctcggcctgcagcggtcgtga

DBGET integrated database retrieval system