KEGG   Frankia sp. EAN1pec: Franean1_1068Help
Entry
Franean1_1068     CDS       T00608                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
fre  Frankia sp. EAN1pec
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:fre01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:fre00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:fre00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:fre00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:fre00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
1259617..1261638
Genome map
AA seq 673 aa AA seqDB search
MTVTGMDAGSGTDGGGGAGGALEAELERLQTVERFDPPPGFARRQPYAADVAAAAADPLA
FWAGKARELLTWQKPFTRVLDDANPPFYKWFDDGELNVSANCLDRHVAAGLGGRVAYHWH
GEEGERRAVTYSELLADTQRLANGLRSLGVVPGDVVGIYLPMIPEVAVAMLACARIGAVH
NVVFGGFAPSAVRERMEVSDAKVLITVDGARRKGRTAAVKAGVDAELGDLPKLEHVVVVR
STGPVGGAETVMTAGRDVWYHELLAAADPLCPPVPLSAEHPLFILYSSGSTAKPKGILHT
TGGYLLGATYTHRTVFDIDPETDVYWCSADVGWITGHSYIVYGPLSNAVTSVMYEGAPDY
PDYDIWWRLIAEYKVTVFYTAPTAIRACIKWGARYPERHDLSSLRLLGSVGEPINPKAWL
WYHQMIGGGRCPIVDTWWQTETGSILISPIPGVTSTKPGSATTPLPGISPALLSEDGEPV
TEGTGVLVITSPWPSMLRTLYRDDERFVQTYFSRFGPRTYVVGDAARLDADGYFWIIGRI
DDVINVSGHRLSTAEVESAIVAHEAVAEAAVVAQSDEDTGQAIVAFVTLRGELVGDDAMV
SQLRDHVAHRIGKLARPRRIIWADDLPKTRSGKIMRRLLRDVAEGRELGDVTTLRDPAVM
SALAAKVATAPDE
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgttacaggcatggacgcaggaagcgggacggacggcggcggcggcgccggtgga
gcgctcgaggccgagctggagcgcctgcagaccgtggagcgcttcgacccgccgccgggt
ttcgcccgtcgccagccgtacgccgccgacgtggcggcggccgcggccgacccgctggcc
ttctgggcgggaaaggcacgcgagctgctgacctggcagaagcccttcacccgcgtcctc
gacgacgcgaacccgccgttctacaagtggttcgacgacggcgagctcaacgtctccgcc
aactgcctggaccggcacgtggcggccggcctgggcggccgggtcgcctaccactggcac
ggcgaggagggtgagcgtcgggccgtcacctactccgagctgctcgccgacacccagcgg
ttggcgaacggcctgcgttccctcggcgtggtcccgggcgacgtcgtcggcatctacctg
ccgatgatccccgaggtcgcggtggccatgctcgcctgcgcccgcatcggcgcggtgcac
aacgtggtcttcggcgggttcgcgccgtccgcggtgcgggagcggatggaggtctccgac
gccaaggtgctgatcaccgtggacggggcccgccgcaagggccgcacggcggcggtcaag
gccggcgtggacgccgagctgggcgacctgccgaagctggagcacgtcgtggtcgtccgc
tccaccgggccggtgggcggggccgagacggtgatgacggccggccgtgacgtctggtac
cacgagctgctcgccgccgccgacccgctgtgcccgccggtgccgctctccgccgagcac
ccgctgttcatcctgtacagctccgggtcgacggcgaagccgaagggcatcctgcacacc
accggcggctacctgctcggcgcgacctacacccaccgcacggtcttcgacatcgacccg
gagaccgacgtctactggtgctccgccgacgtcggctggatcaccggccactcctacatc
gtgtacggcccgctgtcgaacgccgtgacgagcgtgatgtacgagggcgcgccggactac
ccggactacgacatctggtggcggctgatcgccgagtacaaggtcaccgtcttctacacc
gcgccgacggccatccgggcgtgcatcaagtggggagcgcggtacccggagcggcacgac
ctgtcgtcgctgcggctgctcggctcggtcggcgagccgatcaacccgaaggcctggctg
tggtaccaccagatgatcggcggtgggcgctgcccgatcgtcgacacctggtggcagacc
gagaccggctcgatcctgatctcgccgatccccggggtgacgtcgacgaagccggggtcg
gcgacgacgccgctgcccgggatcagcccggcgctgctgtccgaggacggcgagccggtc
accgagggcaccggggtcctggtgatcaccagtccgtggccgtccatgctgcgcacgctc
taccgcgacgacgagcggttcgtgcagacctacttctcccggttcggcccccgcacctac
gtcgtgggcgacgccgcgcggctcgacgcggacggctacttctggatcatcggccggatc
gacgacgtgatcaacgtgtcggggcaccggctgtccaccgccgaggtggagtccgcgatc
gtcgcgcacgaggccgtcgccgaggcggccgtggtggcccagtcggacgaggacaccggc
caggcgatcgtcgcgttcgtgacgctgcgcggcgagctggtcggcgacgacgccatggtc
tcccagctccgggaccacgtcgctcaccggatcggcaagctggcccgcccgcgccgcatc
atctgggccgacgacctgcccaagacccggtccggcaagatcatgcgccggctgctgcgg
gacgtcgccgagggccgcgagctcggtgacgtcacgaccctgcgcgacccggcggtcatg
tccgcgctcgccgcgaaggtcgccaccgcccccgacgagtag

DBGET integrated database retrieval system