KEGG   Frankia sp. EAN1pec: Franean1_1068Help
Entry
Franean1_1068     CDS       T00608                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
fre  Frankia sp. EAN1pec
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Franean1_1068
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Franean1_1068
   00620 Pyruvate metabolism
    Franean1_1068
   00640 Propanoate metabolism
    Franean1_1068
  Energy metabolism
   00680 Methane metabolism
    Franean1_1068
Enzymes [BR:fre01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Franean1_1068
Lipid biosynthesis proteins [BR:fre01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Franean1_1068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
1259617..1261638
Genome map
AA seq 673 aa AA seqDB search
MTVTGMDAGSGTDGGGGAGGALEAELERLQTVERFDPPPGFARRQPYAADVAAAAADPLA
FWAGKARELLTWQKPFTRVLDDANPPFYKWFDDGELNVSANCLDRHVAAGLGGRVAYHWH
GEEGERRAVTYSELLADTQRLANGLRSLGVVPGDVVGIYLPMIPEVAVAMLACARIGAVH
NVVFGGFAPSAVRERMEVSDAKVLITVDGARRKGRTAAVKAGVDAELGDLPKLEHVVVVR
STGPVGGAETVMTAGRDVWYHELLAAADPLCPPVPLSAEHPLFILYSSGSTAKPKGILHT
TGGYLLGATYTHRTVFDIDPETDVYWCSADVGWITGHSYIVYGPLSNAVTSVMYEGAPDY
PDYDIWWRLIAEYKVTVFYTAPTAIRACIKWGARYPERHDLSSLRLLGSVGEPINPKAWL
WYHQMIGGGRCPIVDTWWQTETGSILISPIPGVTSTKPGSATTPLPGISPALLSEDGEPV
TEGTGVLVITSPWPSMLRTLYRDDERFVQTYFSRFGPRTYVVGDAARLDADGYFWIIGRI
DDVINVSGHRLSTAEVESAIVAHEAVAEAAVVAQSDEDTGQAIVAFVTLRGELVGDDAMV
SQLRDHVAHRIGKLARPRRIIWADDLPKTRSGKIMRRLLRDVAEGRELGDVTTLRDPAVM
SALAAKVATAPDE
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgttacaggcatggacgcaggaagcgggacggacggcggcggcggcgccggtgga
gcgctcgaggccgagctggagcgcctgcagaccgtggagcgcttcgacccgccgccgggt
ttcgcccgtcgccagccgtacgccgccgacgtggcggcggccgcggccgacccgctggcc
ttctgggcgggaaaggcacgcgagctgctgacctggcagaagcccttcacccgcgtcctc
gacgacgcgaacccgccgttctacaagtggttcgacgacggcgagctcaacgtctccgcc
aactgcctggaccggcacgtggcggccggcctgggcggccgggtcgcctaccactggcac
ggcgaggagggtgagcgtcgggccgtcacctactccgagctgctcgccgacacccagcgg
ttggcgaacggcctgcgttccctcggcgtggtcccgggcgacgtcgtcggcatctacctg
ccgatgatccccgaggtcgcggtggccatgctcgcctgcgcccgcatcggcgcggtgcac
aacgtggtcttcggcgggttcgcgccgtccgcggtgcgggagcggatggaggtctccgac
gccaaggtgctgatcaccgtggacggggcccgccgcaagggccgcacggcggcggtcaag
gccggcgtggacgccgagctgggcgacctgccgaagctggagcacgtcgtggtcgtccgc
tccaccgggccggtgggcggggccgagacggtgatgacggccggccgtgacgtctggtac
cacgagctgctcgccgccgccgacccgctgtgcccgccggtgccgctctccgccgagcac
ccgctgttcatcctgtacagctccgggtcgacggcgaagccgaagggcatcctgcacacc
accggcggctacctgctcggcgcgacctacacccaccgcacggtcttcgacatcgacccg
gagaccgacgtctactggtgctccgccgacgtcggctggatcaccggccactcctacatc
gtgtacggcccgctgtcgaacgccgtgacgagcgtgatgtacgagggcgcgccggactac
ccggactacgacatctggtggcggctgatcgccgagtacaaggtcaccgtcttctacacc
gcgccgacggccatccgggcgtgcatcaagtggggagcgcggtacccggagcggcacgac
ctgtcgtcgctgcggctgctcggctcggtcggcgagccgatcaacccgaaggcctggctg
tggtaccaccagatgatcggcggtgggcgctgcccgatcgtcgacacctggtggcagacc
gagaccggctcgatcctgatctcgccgatccccggggtgacgtcgacgaagccggggtcg
gcgacgacgccgctgcccgggatcagcccggcgctgctgtccgaggacggcgagccggtc
accgagggcaccggggtcctggtgatcaccagtccgtggccgtccatgctgcgcacgctc
taccgcgacgacgagcggttcgtgcagacctacttctcccggttcggcccccgcacctac
gtcgtgggcgacgccgcgcggctcgacgcggacggctacttctggatcatcggccggatc
gacgacgtgatcaacgtgtcggggcaccggctgtccaccgccgaggtggagtccgcgatc
gtcgcgcacgaggccgtcgccgaggcggccgtggtggcccagtcggacgaggacaccggc
caggcgatcgtcgcgttcgtgacgctgcgcggcgagctggtcggcgacgacgccatggtc
tcccagctccgggaccacgtcgctcaccggatcggcaagctggcccgcccgcgccgcatc
atctgggccgacgacctgcccaagacccggtccggcaagatcatgcgccggctgctgcgg
gacgtcgccgagggccgcgagctcggtgacgtcacgaccctgcgcgacccggcggtcatg
tccgcgctcgccgcgaaggtcgccaccgcccccgacgagtag

DBGET integrated database retrieval system