KEGG   Frankia sp. EAN1pec: Franean1_1113Help
Entry
Franean1_1113     CDS       T00608                                 

Definition
isopropylmalate isomerase large subunit (EC:4.2.1.33)
Orthology
K01703  
3-isopropylmalate/(R)-2-methylmalate dehydratase large subunit [EC:4.2.1.33 4.2.1.35]
Organism
fre  Frankia sp. EAN1pec
Pathway
Valine, leucine and isoleucine biosynthesis
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:fre01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:fre01230]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:fre00660]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:fre00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
1330711..1332108
Genome map
AA seq 465 aa AA seqDB search
MGRTLAEKVWDAHVVRRADGEPDLLYIDLHLVHEVTSPQAFEALRLAGRPVRRPDLTLAT
EDHNVPTTDTLLPIADPVSRAQVEALRKNCADFGVRLFPMNDPDQGIVHVVGPQLGLSEP
GMTIVCGDSHTSTHGAFGALAFGIGTSQVEHVLATQTLPQRRPKTMAVTVQGELPAGVTA
KDLILAVIARIGTGGGAGYVIEYRGEAVRGLSMEGRMTVCNMSIEAGARAGMIAPDETTF
EYLRGRPNAPTGADWDAAVEYWRTLATDPDATFDHEVVIDGPSLSPYVTWGTNPGQAAPL
SSPVPDPAAYADPAARGSVERALAYMDLVPGTPLSDVAVDTVFIGSCTNGRISDLRDAAD
VLRGRQVADGLRVLVVPGSMAVKAEAEAEGLDEVFRAAGADWRSAGCSMCLGMNPDTLRP
GERSASTSNRNFEGRQGPGGRTHLVSPAVAAATAVTGRLTAPADL
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgcacactcgcggagaaggtctgggacgcacacgtcgtccgccgcgcggacgga
gagcccgacctgctctacatcgatctgcacctcgtccacgaggtcacctcgccgcaggcg
ttcgaggcgctgcggctggccgggcgcccggtccgccgtcccgacctgacgctggcgacc
gaggaccacaacgtcccgacgaccgacacgctgctgccgatcgccgacccggtctcgcgg
gcgcaggtcgaggcgctgcgcaagaactgcgccgacttcggggtccgcctgttcccgatg
aacgacccggaccagggcatcgtccacgtggtcggcccgcagctcggcctgtccgagccg
ggcatgacgatcgtctgtggcgacagccacacctcgacgcacggcgccttcggggcgctc
gccttcggcatcggcaccagccaggtcgagcatgtgctggccacccagacgctgccgcag
cgccgcccgaagacgatggcggtcaccgtccagggtgagctgcccgccggggtcaccgcg
aaggacctgatcctcgccgtgatcgcccggatcggcacgggtggcggcgccggctacgtc
atcgagtaccgcggcgaagccgtccgcgggctgtcgatggagggccggatgacggtctgc
aacatgtcgatcgaggcgggcgcgcgcgccgggatgatcgccccggacgagaccacgttc
gagtacctcaggggacgtccgaacgccccgaccggggccgactgggacgccgcggtcgag
tactggcgcaccctggccaccgaccccgacgccacgttcgaccacgaggtcgtcatcgac
gggcccagcctgagcccgtacgtcacctgggggaccaacccgggccaggctgcgccgctg
agctcgcccgtgcccgacccggccgcctatgccgacccggccgcgcgcggctcggtggaa
cgcgccctggcctacatggatctcgtgccgggcaccccgctgtccgacgtcgccgtcgac
accgtcttcatcggatcctgcaccaacggccggatctccgacctgcgtgacgccgccgac
gtgctgcgcgggcgccaggtggcggacggccttcgggtcctggtcgtccccggctcgatg
gcggtcaaggccgaggcggaggcggagggcctcgacgaggtgttccgcgccgcgggcgcc
gactggcgtagcgccggctgctcgatgtgcctgggcatgaacccggacaccctgcggccg
ggggagcgcagcgcgtcgacgtccaaccgcaacttcgagggccggcagggccccggcggg
cgaacccacctcgtctcgccggcggtcgccgccgccaccgcggtgaccggccgcctcacg
gcgcccgccgacctgtag

DBGET integrated database retrieval system