KEGG   Frankia sp. EAN1pec: Franean1_1168Help
Entry
Franean1_1168     CDS       T00608                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
fre  Frankia sp. EAN1pec
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Franean1_1168
Enzymes [BR:fre01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Franean1_1168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
1391425..1392720
Genome map
AA seq 431 aa AA seqDB search
MNRTGLGRSVEGPARIGSVAEASVQREVVLLGSTGSIGTQAIDVVRRNPDRFRVVALMGG
GSRVDLLAAQALDLGVEAVGVAAASSAQDLQLAFFAEASKRGYRRGEFAVPKILAGPDAA
VEIASWPADIVLNGVSGSVGLAPTLAALKAGATVGLANKESLVAGGPLVLDALGGNPDRL
VPVDSEHSALAQCLRGGRREEVHKLVLTASGGPFRGRSRDDLAGVTREQALAHPTWAMGP
LVTINSATLMNKGLELIEAHLFFGVPYDDIEVVVHPQSLVHSMVEFNDGSTIAQVSPPDM
RLPIALALGWPDRVPLAQPPMDWTRAQSLTFEPLDTVAFPAVDLARTAGRLGGTAPAVFN
AANEEAVAAFLAGQLPFVRIVDLVAEVVQAHEVIARPTLDEVFAVEREARAAANRLIEKA
GGHPVAAGGHG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgaacaggcctcggtcgaagcgtcgaagggcctgcgagaataggcagcgtggcg
gaggcttcggtccagcgtgaggttgttctgctcgggtccaccggctcgatcgggactcag
gcgatagatgtcgtacgccgcaacccggacaggttccgggtggtggcgctgatgggaggc
gggtcgcgggtcgacctgctcgcggcgcaggcgctcgacctgggggtcgaggcggtcggt
gtggccgcggcctcgtcggcgcaggaccttcagctcgcgttcttcgcggaggcgtccaag
cgcggctaccgccgtggcgagttcgccgtcccgaagatcctcgcggggccggacgcggcc
gtcgagatcgcgtcctggccggcggacatcgtcctcaacggggtgtccggctcggtcggg
ctcgcgccgacgctggcggctctcaaggccggcgcgacggtggggctggcgaacaaggag
tcgctggtcgcgggtggtccgctggtgctcgacgcgctcggcggcaacccggaccggctc
gtcccagtggattccgagcactcggcgctcgcgcagtgcctgcgcgggggtcggcgtgag
gaagtccacaagctggtgctgaccgccagcggcgggcccttccgtggccggagcagggac
gacctggccggggtcacccgggagcaggcactggcccatccgacctgggcgatggggccg
ctggtcacgatcaactcggcgacgctgatgaacaagggcctcgagctgatcgaggcccac
ctgttcttcggtgtgccgtatgacgacatcgaggtcgtcgtccacccgcagtcgctggtc
cactcgatggtcgagttcaacgacgggtcgaccatcgcccaggtgtcgccgccggacatg
cggctcccgatcgcgctggccctgggctggccggaccgggtgccgctggcccagccgccg
atggactggacgcgcgcccagtcgctgaccttcgagcccctggacaccgtcgcgttcccc
gcggtggacctcgcccggacggcgggccgcctcggcgggaccgcgccggccgtgttcaac
gcggcgaacgaggaggccgtcgcggccttcctcgccgggcagttgccgttcgtccgtatc
gtcgacctggtggccgaggtggtgcaggcacacgaggtgatcgcccgtccgacgctggac
gaggtgttcgccgtcgaacgtgaggcccgcgccgccgcgaaccgcctgatcgagaaggcc
ggcgggcatcccgtggcggccggaggacatggttga

DBGET integrated database retrieval system