KEGG   Frankia sp. EAN1pec: Franean1_1196Help
Entry
Franean1_1196     CDS       T00608                                 

Definition
putative phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
fre  Frankia sp. EAN1pec
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Franean1_1196
Enzymes [BR:fre01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Franean1_1196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
1426213..1428621
Genome map
AA seq 802 aa AA seqDB search
MINVAEIGAESGVQSTGPLSTEELRLIDAYWRAANYLAVGQIYLLDNPLLTEPLRAEHIK
PRLLGHWGTTPGLNLIYAHMNRVIRRNDLDAIYVIGPGHGGPGIVANTYLEGTYSEIYPS
VTQDREGLRRLFRQFSFPGGIPSHVAPEVPGSIHEGGELGYALTHAYGAAFDNPGLVVAA
VVGDGEAETGPLAASWHSNKFLDPVRDGAVLPILHLNGYKIAQPTILARIPESELDALMR
GYGHEPLHVTGDDPADVHQQFARVLDTAVSRIFDIQDRARRGGDSSRPVWPMIVLRTPKG
WTGPSTVDGRPVEGNWRSHQVPIAELHGNPEHLALLESWLRSYRPWELFDADGRLVPELA
ALAPVGTRRMSANPHANGGELLRDLTLPDFRDYAVDVPQPGVGSNEATRVLGGFLRDVMR
SNPNTFRVMGPDETASNRLGALFETTSRAWNAETVPTDEDLAPDGRVMEVLSEHLCQGWL
EGYLLTGRHGFFSCYEAFIHIVDSMVNQHAKWLKATRHIPWRRPIASLNYLLTSHVWRQD
HNGFSHQDPGFIDHVVNKKAEIIRVYLPPDANTLLSVADHCLRSRHYINVIVAGKQPALN
YLPMSDAIAHCTRGLGIWDWASNDHTEDGDGTPDVVMACAGDIPTLETLAAVDILRQNFP
ELKVRVVNVVDLMCLQAEAEHPHGMSDARFDALFTEDRPIIFAYHGYPWLIHRLTYRRRN
HGNLHVRGYIEEGTTTTPFDMVMMNNLDRFHLVVDVIDRVASLGARAAHVRQRMIDARLA
ARAYTRDHGEDDPRIRDWTWPY
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacgtcgccgagatcggcgcggagtccggtgtgcagagcacggggccgctgtcc
accgaggagctgcgactgatcgacgcctattggcgcgccgccaactacctcgcggtgggg
cagatctacctgctcgacaatccgttgctcaccgagccgctgcgggccgagcacatcaag
ccacggctgctcgggcactggggtaccacgcccgggctcaacctcatctacgcccacatg
aaccgcgtcatccgccgcaacgacctcgacgcgatctacgtgatcggccctggccacggc
gggccgggaatcgtggccaacacctacctcgagggcacgtacagcgagatctacccctcc
gtcacccaggacagggaggggctgcgccggctgttccggcagttctcgttccccggggga
attcccagccatgtggcgccggaggtgcccggttccattcatgaaggcggtgagctgggg
tacgcgctcacccacgcctacggcgccgccttcgacaacccgggcctggtggtcgccgcc
gtcgtcggtgacggcgaggcggagaccggcccgctggcggcgagctggcactccaacaag
ttcctcgacccggtgcgcgacggcgcggtgctgccgatcctgcacctcaacgggtacaag
atcgctcagccgacgatcctcgctcgcatccccgagtcggagctcgacgcgctgatgcgc
ggctacggccacgagccgctgcacgtcaccggcgatgaccccgccgacgtccaccagcag
ttcgcccgggtgctcgacaccgccgtctcgcggatcttcgacattcaggaccgcgcccgc
cgcggcggcgactcgtcccgccccgtgtggccgatgatcgtcctgcgcacgccgaagggg
tggacgggtccgtcgacggtcgacggccggccggtcgaggggaactggcgctcgcaccag
gtgccgatcgccgagctgcacggcaaccccgagcatctcgccctgctggagtcgtggctg
cgcagctaccggccatgggagctgttcgacgccgacgggcggctggtcccggagctggcg
gcgctggctcccgtgggcacccgccggatgagcgcgaacccgcacgccaacggcggtgag
ctgctgcgtgacctgacgttgccggacttccgcgactacgccgtcgacgtcccgcagccg
ggagtgggctccaacgaggcgacgcgggtgctcggcggcttcctgcgcgacgtcatgcgc
tcgaacccgaacaccttccgcgtgatgggcccggacgagaccgcgtcgaaccgcctcggg
gcgttgttcgagaccacgtcccgggcctggaacgccgagacggtgccgaccgacgaggac
ctcgccccggacggccgggtgatggaggtgctctccgagcacctgtgccagggctggctg
gagggctacctgctcaccggccggcacggcttcttctcgtgctatgaggcgttcatccac
atcgtcgactcgatggtgaaccagcacgcgaaatggctgaaggcgacccggcacattccc
tggcgccggccgatagcctccctgaactacctgctcaccagccatgtctggcgccaggac
cacaacggcttctcgcaccaggacccgggcttcatcgaccacgtggtcaacaagaaagcc
gagatcatccgggtctacctgccgccggacgcgaacacgctgctctcggtggccgaccac
tgcctgcgcagccggcattacatcaacgtcatcgtcgccggcaagcagccggcactgaac
tacctgccgatgtcggacgcgatcgcgcactgcacccgcggcctgggtatctgggactgg
gcgagcaacgaccacaccgaggacggcgacggcacccccgacgtcgtcatggcctgcgcc
ggggacatcccgaccctggagacgctggccgcggtcgacatcctgcgccagaacttcccc
gagctgaaggtgcgggtcgtcaacgtcgtcgacctgatgtgcctgcaggcggaggccgag
cacccgcacggcatgtccgacgcgcgcttcgacgcgctgttcaccgaggaccggccgatc
atcttcgcctaccacggctacccatggctgatccaccgcctcacctaccggcggcggaac
cacggcaacctgcacgtccgcggctacatcgaggagggcacgacgaccacgcccttcgac
atggtcatgatgaacaacctcgaccgcttccacctggtcgtggacgtgatcgaccgggtc
gccagcctcggcgcccgcgcggcgcacgtcaggcagcgaatgatcgacgcccgtctcgcc
gcccgcgcctacacccgcgaccatggcgaggacgacccgcgcatccgtgactggacgtgg
ccttactga

DBGET integrated database retrieval system