KEGG   Frankia sp. EAN1pec: Franean1_1252Help
Entry
Franean1_1252     CDS       T00608                                 

Definition
polyphosphate--glucose phosphotransferase (EC:2.7.1.63)
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
fre  Frankia sp. EAN1pec
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Franean1_1252
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Franean1_1252
   00520 Amino sugar and nucleotide sugar metabolism
    Franean1_1252
Enzymes [BR:fre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Franean1_1252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(1509175..1510020)
Genome map
AA seq 281 aa AA seqDB search
MREDGAMRVFGVDIGGTGIKGAPVDIEDGTLAAPRFRLPTPQPADPESVARTVAEVVAHF
EWTGPVGATFPAVIKSGVARTAANVDEAWIDTDVSAVLGGALGPALAGSEVAVVNDADAA
GVAEMAFGAGRDTSGLVVMTTFGTGIGTALFLHGQLVPNTELGHLEIQGHDAETRASEAV
REREDLSWEKWAKRVNRYLSTLEALLWPDLIIIGGGASRKAEKFFDHLELRTKVVPAQLQ
NEAGVVGAALYAGGDQTRARPAPRPARRRGPATRPPGGRRP
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgcgggaggacggcgcaatgcgggtcttcggggtcgacatcggtgggacgggcatcaag
ggcgccccggtcgacatcgaggatggcacgctggctgcgccgcggttccggctcccgacg
ccgcagcccgcggacccggagtcggtcgcgcggaccgtcgcggaggtcgtcgcgcacttc
gagtggacgggcccggtcggcgccacgttcccggcggtgatcaagtccggggtcgcccgc
accgccgcgaacgtcgacgaggcctggatcgacaccgacgtctccgcggtgctcggcggg
gcactcgggccggcgctggccggctcggaggtcgccgtcgtcaacgacgccgacgccgcc
ggggtggccgagatggcgttcggcgccggccgtgacacctccggcctcgtcgtcatgacg
acgttcggcaccgggatcgggacggcgctgttcctgcacggccagctcgtaccgaacacc
gagctggggcacctggagatccaaggccacgacgcggagacgcgggcgtccgaggccgtc
cgggagcgtgaggatctctcctgggagaagtgggccaagcgggtcaaccgctacctgagc
accctcgaggccctgttgtggccggatctgatcatcatcggcggcggcgccagccggaag
gcggagaagttcttcgaccacctcgaactgcgcacgaaggtggtgcccgcccagctccag
aacgaggcgggcgtcgtcggggcggcgctgtacgccggcggtgaccagacccgcgcccgg
cccgcaccgcgcccggcgcgccggcgcgggccggcgacccggccgcccggcggccgtcgc
ccctga

DBGET integrated database retrieval system