KEGG   Frankia sp. EAN1pec: Franean1_1494Help
Entry
Franean1_1494     CDS       T00608                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
fre  Frankia sp. EAN1pec
Pathway
fre00860  Porphyrin and chlorophyll metabolism
fre01100  Metabolic pathways
fre01110  Biosynthesis of secondary metabolites
fre01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Franean1_1494
Enzymes [BR:fre01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Franean1_1494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C DUF4853
Motif
Other DBs
NCBI-ProteinID: ABW10934
RhizoBase: Franean1_1494
UniProt: A8LA54
Position
1794993..1796144
Genome map
AA seq 383 aa AA seqDB search
MTDSGPVTAPVEPLAGYTVALTAARRREEFGAALERRGAKVVYAPAIRIVPLADDARLRE
ATERCIAAPVDVVVATTGIGFRGWVDAAETWGLADRLVAAFESADLLARGPKARGAIRAT
GLREAWSPESESSSEVMSYLTAHGGLDGKRIAVQLHGEPLPDMVQTLCAAGAEVIEIPVY
RWVPAQDMAPVRRVVECVAARSLDAVAFTSAPAAASFLQTADEMALRSAAAEAMRGPVVA
ACVGPVTAAPLGRAGIPCVIPSRGRLGALVREIVEQVPIRRGLRLRVGERALDVRGHAVA
VDGVLVALPAASMTLLRALAARPGYVVSRADLLNLTGTTDEHALEVAVGRLRTSLGDPAL
IRTVVKRGYRLDCEPVSASSGCL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgactccggcccggtgacggcgcccgtcgagccgctcgccggttacacggtcgcg
ctcaccgcggcgcgccggcgtgaggagttcggcgcggccctggagcgacgcggcgccaag
gtcgtctacgcccccgccatacgcatcgtgccgctcgcggacgacgcccggctgcgggag
gccaccgaacgctgcatcgccgcacccgtggacgtcgtcgtcgccaccaccggaatcggc
ttccggggctgggtcgacgcggccgagacgtggggtctcgccgaccggctggtcgcggcg
ttcgagtcggcggacctgctggcacgcgggccgaaggcgcgcggtgcgatccgggcaacc
gggctgcgtgaggcgtggtcacccgagtcggagtcatcctccgaggtcatgtcatacctg
accgcccacggtggcctggacggcaagcggatcgcggtgcagctgcacggcgagccactg
ccggacatggtccagacgctgtgcgcggcaggcgccgaggtcatcgagattcccgtctac
cggtgggtcccggcgcaggacatggctcccgtccgccgcgtggtggagtgcgtcgcggca
cggtcgctggacgcggtcgcgttcacgagcgcgcccgccgccgcgagcttcctgcagaca
gccgacgagatggcgctgcgatccgccgccgcggaggcgatgcgcggcccggttgtcgcc
gcctgcgtcggcccggtgacggccgctcccctcgggcgggctgggattccgtgcgtgatc
ccgtcgcggggacgtctgggcgcgcttgtccgggagatcgtggagcaggtgcccatccgg
cgtggcctgcgactgcgcgtcggcgagcgcgcgctggacgtccgtggccacgccgtggcc
gtcgacggtgtgctcgtcgcgctgcccgccgcctcgatgacgctgctgcgcgccctggcg
gccaggcctggctatgtcgtctcccgggcggacctgctcaacctgaccggcacgaccgac
gagcacgcgctcgaggtcgccgtgggccgcctgcgcacgtcgctcggcgaccccgccctc
atccggaccgtggtgaagcgcggataccggctcgactgtgagccggtatccgcctcctcc
gggtgcctctag

DBGET integrated database retrieval system