KEGG   Frankia sp. EAN1pec: Franean1_1494Help
Entry
Franean1_1494     CDS       T00608                                 

Definition
bifunctional uroporphyrinogen-III synthetase/response regulator domain-containing protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
fre  Frankia sp. EAN1pec
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Franean1_1494
Enzymes [BR:fre01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Franean1_1494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
1794993..1796144
Genome map
AA seq 383 aa AA seqDB search
MTDSGPVTAPVEPLAGYTVALTAARRREEFGAALERRGAKVVYAPAIRIVPLADDARLRE
ATERCIAAPVDVVVATTGIGFRGWVDAAETWGLADRLVAAFESADLLARGPKARGAIRAT
GLREAWSPESESSSEVMSYLTAHGGLDGKRIAVQLHGEPLPDMVQTLCAAGAEVIEIPVY
RWVPAQDMAPVRRVVECVAARSLDAVAFTSAPAAASFLQTADEMALRSAAAEAMRGPVVA
ACVGPVTAAPLGRAGIPCVIPSRGRLGALVREIVEQVPIRRGLRLRVGERALDVRGHAVA
VDGVLVALPAASMTLLRALAARPGYVVSRADLLNLTGTTDEHALEVAVGRLRTSLGDPAL
IRTVVKRGYRLDCEPVSASSGCL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgactccggcccggtgacggcgcccgtcgagccgctcgccggttacacggtcgcg
ctcaccgcggcgcgccggcgtgaggagttcggcgcggccctggagcgacgcggcgccaag
gtcgtctacgcccccgccatacgcatcgtgccgctcgcggacgacgcccggctgcgggag
gccaccgaacgctgcatcgccgcacccgtggacgtcgtcgtcgccaccaccggaatcggc
ttccggggctgggtcgacgcggccgagacgtggggtctcgccgaccggctggtcgcggcg
ttcgagtcggcggacctgctggcacgcgggccgaaggcgcgcggtgcgatccgggcaacc
gggctgcgtgaggcgtggtcacccgagtcggagtcatcctccgaggtcatgtcatacctg
accgcccacggtggcctggacggcaagcggatcgcggtgcagctgcacggcgagccactg
ccggacatggtccagacgctgtgcgcggcaggcgccgaggtcatcgagattcccgtctac
cggtgggtcccggcgcaggacatggctcccgtccgccgcgtggtggagtgcgtcgcggca
cggtcgctggacgcggtcgcgttcacgagcgcgcccgccgccgcgagcttcctgcagaca
gccgacgagatggcgctgcgatccgccgccgcggaggcgatgcgcggcccggttgtcgcc
gcctgcgtcggcccggtgacggccgctcccctcgggcgggctgggattccgtgcgtgatc
ccgtcgcggggacgtctgggcgcgcttgtccgggagatcgtggagcaggtgcccatccgg
cgtggcctgcgactgcgcgtcggcgagcgcgcgctggacgtccgtggccacgccgtggcc
gtcgacggtgtgctcgtcgcgctgcccgccgcctcgatgacgctgctgcgcgccctggcg
gccaggcctggctatgtcgtctcccgggcggacctgctcaacctgaccggcacgaccgac
gagcacgcgctcgaggtcgccgtgggccgcctgcgcacgtcgctcggcgaccccgccctc
atccggaccgtggtgaagcgcggataccggctcgactgtgagccggtatccgcctcctcc
gggtgcctctag

  All links  
No link information was found.   
DBGET integrated database retrieval system