KEGG   Frankia sp. EAN1pec: Franean1_1573Help
Entry
Franean1_1573     CDS       T00608                                 

Definition
alcohol dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
fre  Frankia sp. EAN1pec
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Franean1_1573
  Energy metabolism
   00680 Methane metabolism
    Franean1_1573
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Franean1_1573
Enzymes [BR:fre01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Franean1_1573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
1878602..1879735
Genome map
AA seq 377 aa AA seqDB search
MRAVVYREPFQVAVADVPDPRVEHPQDAIVRVSSTSICGSDLHVYEGRTSVRPGTVLGHE
NMGTVVDRGSAVSHVQLGDRVSVPCTVSCGTCANCERGRTEFCLRTNPDPHRAGAAYGCP
DMGPYLGGQAEYLRVPFADFNLLRLPPGDDQELDFATLSDVFPTGFHGTELADVQAGNTV
VVFGAGPVGLLAAYSAALRGATALVVDPVPSRLRLCERIGATGIDSSTEDAAERVREETR
GRGVDCGIDAVGYQARTASGEEQAGLVLNQLVDCVRWTGSIGVLGVYPTRDPGAADESGA
RGRLPFDMGAFFAKGLRMGSGPANVKRYNRFLRDLIITGRAQPSCVMSHQLPLADAPDAY
ARFDHRDAGWIKITLQP
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagtcgtctaccgggaaccgttccaggtggccgtggcggacgtccccgacccg
cgcgtcgagcatccgcaggacgcgatcgtgcgggtctcctcgacgagcatctgcggttcc
gatctgcacgtgtacgagggacgtaccagtgtgcggcccggcacggttctcggccacgag
aacatgggcacggtcgtcgaccgcgggtcggcggtgagccacgtccagctcggcgaccgg
gtctccgttccctgcaccgtctcctgcgggacgtgcgcgaactgcgagcggggccggaca
gagttctgcctgcgcaccaaccccgacccgcaccgggccggagcggcgtacggctgcccg
gacatgggcccctacctcggcgggcaggccgagtacctccgggtgccgttcgccgacttc
aacctgctgcggctgccgccgggcgacgaccaggagctcgacttcgcaaccctctccgac
gtcttccccaccggcttccacggcaccgagctggccgacgtccaggccgggaacacggtt
gtcgtgttcggcgcagggccggtcggcctgctggcggcgtactcggccgccctgcgcggc
gccaccgcgctggtggtcgatcccgtgccctcccggctccgcctgtgcgagcggatcggc
gccaccgggatcgactcgtccaccgaggacgccgcggaacgggtgcgggaggagacacgc
ggccgcggcgtcgactgcggcatcgacgccgtcggctaccaggccaggacggcgtccggc
gaggagcaggccggcctcgtcctgaaccagctcgtcgactgcgtgcgctggacgggctcg
atcggtgtcctcggcgtgtaccccacccgcgaccccggtgccgccgacgagagcggcgca
cgcggccgactcccgttcgacatgggcgccttcttcgcgaaggggctgcggatgggcagc
gggccggccaatgtgaaacggtacaaccggttcctgcgcgatctcatcatcaccggccgg
gcgcagccgtcctgcgtcatgtcccatcagctgccgctggccgacgcacccgacgcctac
gcccgcttcgaccaccgggacgcgggctggatcaagatcaccctccagccctga

DBGET integrated database retrieval system