KEGG   Frankia sp. EAN1pec: Franean1_1706Help
Entry
Franean1_1706     CDS       T00608                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
fre  Frankia sp. EAN1pec
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Franean1_1706 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Franean1_1706 (pyrB)
Enzymes [BR:fre01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Franean1_1706 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
2037609..2038538
Genome map
AA seq 309 aa AA seqDB search
MNHLLSTADLKLDDALLVLDTADRMARVADAPVRKLPTLRGRTVVNLFFEDSTRTRTSFE
VAAKRLSADVINFSARGSSVSKGESLKDTAQTLEAMGADAVVCRHPASGAPHRLASWVRG
SVVNAGDGTHEHPTQALLDAFTIRRRLGRLDGLAVTIVGDVLHSRVARSNVWLLTTLGAR
VTVVAPPTLLPLGISGWPVEVSYDLESVLPKSDVVMMLRVQRERMSAAFFPTEREYSRRY
GLDADRAALMPEHALVMHPGPMVRGMEIASSVADSPRSTVVEQVANGVSVRMAVLYLLLG
GSGAERESS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaccatctgctttccaccgcggatctcaagctcgacgacgcgctgctggtgctcgac
acggcggaccgcatggcgcgggtcgcggacgcgccggtccgcaagctgccgacgctgcgc
ggccggaccgtggtcaatctgttcttcgaggactccacccgtacccgcacgtccttcgag
gtcgccgccaagaggctgtcggcagatgtgatcaatttttcggcccgggggtcaagcgtg
tcgaagggcgagagcctgaaggacacagcgcagaccctcgaggcgatgggcgcggacgcc
gtcgtctgccgtcatcccgcgagcggcgccccgcaccggctggccagctgggtgcgcggc
agcgtcgtgaacgccggtgacggtacgcacgagcaccccacccaggcgctgctcgacgcc
ttcaccatccgccgccggctcggccggctggacgggctggccgtgacgatcgtcggggac
gtcctgcactcgcgggtggcccgctccaatgtctggttgctgacgaccctcggtgcgcgg
gtgaccgtggtcgccccgcccacgctgctgccgctcggtatctccgggtggcccgtcgag
gtgtcctacgacctcgagtcggtcctgcccaagagcgacgtggtcatgatgttgcgtgtg
cagcgggagcggatgtccgcggcgttcttcccgaccgagcgggagtacagccgccgttac
ggcctcgacgcggaccgggccgcgctcatgcccgagcatgccctggtcatgcaccccggg
ccgatggtccgcgggatggagatcgcctcctcggtggccgactcgccgcgctcgacggtg
gtcgagcaggtcgcgaacggcgtgagcgtccgcatggccgtcctctacctgctgctcggc
ggcagcggcgccgaacgggagtcctcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system