KEGG   Frankia sp. EAN1pec: Franean1_1779Help
Entry
Franean1_1779     CDS       T00608                                 

Definition
2-oxoglutarate dehydrogenase E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fre  Frankia sp. EAN1pec
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Franean1_1779
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Franean1_1779
  Amino acid metabolism
   00310 Lysine degradation
    Franean1_1779
Enzymes [BR:fre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Franean1_1779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(2137072..2138520)
Genome map
AA seq 482 aa AA seqDB search
MSVSVTMPRLGESVSEGTVTRWLKKEGERVEADEPLLEVSTDKVDTEIPAPASGVLGSIK
VAEDETVEVGVELAVIEDGAAGAGAAAAPAEAPAAAPEPPPAPAAAAPPPPPAPPAPSAP
APAPAAAPPPPPAPATPVPAQAPVAAPDAAADGLGRYVTPLVRKMAAELGVDLGSVTGSG
PGGRITKQDIQDAAKSRGSAPAAAPSAPAAPAVPAAPAPAQAPAAPAAARPAPAAAPTAS
TAPRGRTEKLTRLRSLVARRMVESLQVSAQLTTVVEADVTRIAKLRERAKANFQAREGVK
LSFLPFFAVAACEALREHPGINSSIDLEAGTVTYHDSENLGIAVDTDRGLVVPVIHNASD
LNLSGMARKIDELAARTRANQVSPDDLGGGTFTLTNTGSRGALFDTPIINQPQVAILGTG
SVVKRPAVVTDPELGEVIAIRSKVYLALTYDHRIVDGADAARFLTAIASRLEEGAFEAEL
GL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtatccgtcacgatgccccgcctcggggagagcgtctccgaggggacggtcacc
cgctggctgaagaaggaaggcgagcgggtcgaggccgacgagccgctcctcgaggtcagc
accgacaaggtcgacaccgagatccccgcgccggcctccggcgtgctcggctcgatcaag
gtcgccgaggacgagaccgtcgaggtcggcgtcgagctggctgtcatcgaggacggcgcc
gcgggtgccggcgcggcggccgcgcccgccgaggcccccgccgcggccccggagcctccg
ccggcgcctgccgccgccgcgccgcccccgccgcctgctccccccgctccgtcggcgccg
gcgcccgctcccgcggcggcaccgcctccgccgccggctcccgccacgccggtgcccgcg
caggccccggtcgccgccccggacgccgccgccgacggtctcggccggtacgtgacgccg
ctggtccgcaagatggccgcggagctgggcgtcgacctcggctcggtcaccggcagcggc
ccgggtggacgcatcaccaagcaggacatccaggacgcggcgaagtcccgcggctccgcg
ccggccgcggctcccagcgcccccgccgctccggctgtgccggccgctcccgccccggcg
caggcccccgcggcgcccgcggccgcccggccggctcccgccgccgcgccgaccgcgtcc
accgcgccccgtggccgcaccgagaagctgacccggctgcgctcgctggtcgcccgtcgg
atggtcgagtcgctgcaggtcagcgcgcagctcaccaccgtcgtggaggccgacgtcacg
cggatcgcgaagctgcgcgagcgggccaaggcgaacttccaggcccgcgagggcgtgaag
ctgtcgttcctgccgttcttcgcggtggccgcgtgcgaggcactgcgcgagcacccgggg
atcaactccagcatcgacctggaggcgggcacggtcacctaccacgactcggagaacctc
ggcatcgccgtcgacaccgaccgtggcctggtcgtcccggtgatccacaacgccagcgac
ctgaacctcagcgggatggcccgcaagatcgacgagctggccgcgcggacccgcgccaac
caggtgtccccggacgacctgggcggtggcaccttcacgctgaccaacaccggcagccgc
ggcgccctgttcgacaccccgatcatcaaccagccgcaggtggcgatcctgggcaccggg
tcggtcgtgaagcgcccggccgtcgtcaccgatcccgagctcggcgaggtgatcgccatc
cggtcgaaggtctacctggccctcacctacgaccaccggatcgtggatggcgccgacgcg
gcccggttcctcaccgcgatcgccagccgtctcgaggaaggcgccttcgaggccgagctc
gggctgtag

DBGET integrated database retrieval system