KEGG   Frankia sp. EAN1pec: Franean1_1779Help
Entry
Franean1_1779     CDS       T00608                                 

Definition
2-oxoglutarate dehydrogenase E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fre  Frankia sp. EAN1pec
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Franean1_1779
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Franean1_1779
  Amino acid metabolism
   00310 Lysine degradation
    Franean1_1779
Enzymes [BR:fre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Franean1_1779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(2137072..2138520)
Genome map
AA seq 482 aa AA seqDB search
MSVSVTMPRLGESVSEGTVTRWLKKEGERVEADEPLLEVSTDKVDTEIPAPASGVLGSIK
VAEDETVEVGVELAVIEDGAAGAGAAAAPAEAPAAAPEPPPAPAAAAPPPPPAPPAPSAP
APAPAAAPPPPPAPATPVPAQAPVAAPDAAADGLGRYVTPLVRKMAAELGVDLGSVTGSG
PGGRITKQDIQDAAKSRGSAPAAAPSAPAAPAVPAAPAPAQAPAAPAAARPAPAAAPTAS
TAPRGRTEKLTRLRSLVARRMVESLQVSAQLTTVVEADVTRIAKLRERAKANFQAREGVK
LSFLPFFAVAACEALREHPGINSSIDLEAGTVTYHDSENLGIAVDTDRGLVVPVIHNASD
LNLSGMARKIDELAARTRANQVSPDDLGGGTFTLTNTGSRGALFDTPIINQPQVAILGTG
SVVKRPAVVTDPELGEVIAIRSKVYLALTYDHRIVDGADAARFLTAIASRLEEGAFEAEL
GL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtatccgtcacgatgccccgcctcggggagagcgtctccgaggggacggtcacc
cgctggctgaagaaggaaggcgagcgggtcgaggccgacgagccgctcctcgaggtcagc
accgacaaggtcgacaccgagatccccgcgccggcctccggcgtgctcggctcgatcaag
gtcgccgaggacgagaccgtcgaggtcggcgtcgagctggctgtcatcgaggacggcgcc
gcgggtgccggcgcggcggccgcgcccgccgaggcccccgccgcggccccggagcctccg
ccggcgcctgccgccgccgcgccgcccccgccgcctgctccccccgctccgtcggcgccg
gcgcccgctcccgcggcggcaccgcctccgccgccggctcccgccacgccggtgcccgcg
caggccccggtcgccgccccggacgccgccgccgacggtctcggccggtacgtgacgccg
ctggtccgcaagatggccgcggagctgggcgtcgacctcggctcggtcaccggcagcggc
ccgggtggacgcatcaccaagcaggacatccaggacgcggcgaagtcccgcggctccgcg
ccggccgcggctcccagcgcccccgccgctccggctgtgccggccgctcccgccccggcg
caggcccccgcggcgcccgcggccgcccggccggctcccgccgccgcgccgaccgcgtcc
accgcgccccgtggccgcaccgagaagctgacccggctgcgctcgctggtcgcccgtcgg
atggtcgagtcgctgcaggtcagcgcgcagctcaccaccgtcgtggaggccgacgtcacg
cggatcgcgaagctgcgcgagcgggccaaggcgaacttccaggcccgcgagggcgtgaag
ctgtcgttcctgccgttcttcgcggtggccgcgtgcgaggcactgcgcgagcacccgggg
atcaactccagcatcgacctggaggcgggcacggtcacctaccacgactcggagaacctc
ggcatcgccgtcgacaccgaccgtggcctggtcgtcccggtgatccacaacgccagcgac
ctgaacctcagcgggatggcccgcaagatcgacgagctggccgcgcggacccgcgccaac
caggtgtccccggacgacctgggcggtggcaccttcacgctgaccaacaccggcagccgc
ggcgccctgttcgacaccccgatcatcaaccagccgcaggtggcgatcctgggcaccggg
tcggtcgtgaagcgcccggccgtcgtcaccgatcccgagctcggcgaggtgatcgccatc
cggtcgaaggtctacctggccctcacctacgaccaccggatcgtggatggcgccgacgcg
gcccggttcctcaccgcgatcgccagccgtctcgaggaaggcgccttcgaggccgagctc
gggctgtag

DBGET integrated database retrieval system