KEGG   Frankia sp. EAN1pec: Franean1_1825Help
Entry
Franean1_1825     CDS       T00608                                 

Definition
ROK family glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
fre  Frankia sp. EAN1pec
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Franean1_1825
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Franean1_1825
   00052 Galactose metabolism
    Franean1_1825
   00500 Starch and sucrose metabolism
    Franean1_1825
   00520 Amino sugar and nucleotide sugar metabolism
    Franean1_1825
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Franean1_1825
   00524 Butirosin and neomycin biosynthesis
    Franean1_1825
Enzymes [BR:fre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Franean1_1825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
2189767..2190738
Genome map
AA seq 323 aa AA seqDB search
MTTGSATAPEGDGDLAIGVDVGGTKVAAGVVDAQGRMLASARRPTPSHAPAEVADAIAEL
VAGLRQEYDVRAVGIGAAGWIDRDRSTVLFAPNLAWRDEPLRDVVAERVGLPVVVENDAN
AMAWAEYRFGAGRGQADLVCVTVGTGIGGGIVLDGRLHRGAFGIGAEMGHMQVVPGGHLC
GCGNRGCWEQYASGRALVRVAQEMATASPEAARTMLAGRSVEELSGPDVTTAAQDGDPAA
VKCFEEIGHWLGQGLASLTAILDPGRFVIGGGVSDAGELLVGPARAQYRAGLSGRGHRPE
ADVVVATLGSSAGIVGAADLARM
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccgggtcagcgaccgcccccgagggggacggcgacctggcgatcggagtcgac
gtcggcgggacgaaagttgccgccggtgtcgtcgacgcccagggcaggatgctggcctcc
gcccgacggcccaccccgagccatgccccggccgaggtcgccgacgccatcgccgagctc
gtcgccgggctccgccaggagtacgacgtccgcgccgtgggcatcggcgcggcgggatgg
atcgaccgcgaccggtcgaccgtcctcttcgccccgaacctggcctggcgcgacgagccg
ctgcgcgacgtcgtggcggagcgggtcggcctgcccgtggtcgtcgagaacgacgccaac
gcgatggcctgggccgagtaccgcttcggcgccgggcgcggccaggccgacctcgtctgc
gtcaccgtcggcaccggtatcggcggcggcattgtcctggacggccggctgcaccgcggc
gcgttcggcatcggcgccgagatgggccacatgcaggtggtcccgggcggccacctgtgc
ggctgtgggaaccgcggctgctgggagcagtacgccagcggacgggccctcgtccgggtc
gcccaggagatggccaccgcgtccccggaggccgcccgcacgatgctggccggtcgctcc
gtcgaggagctgagcgggccggacgtcaccaccgccgcccaggacggcgacccggccgcg
gtgaagtgcttcgaggagatcggccactggctcggccagggcctggcgagcctgacggcg
atcctcgacccgggccggttcgtcatcggtggcggcgtatcggacgcgggggagctgctg
gtcgggcccgcccgcgcccagtaccgggcggggctgtcgggccgcgggcaccggccggag
gccgacgtggtggtggccaccctcggctcctccgccggcatcgtcggcgccgccgacctc
gcccgcatgtag

DBGET integrated database retrieval system