KEGG   Frankia sp. EAN1pec: Franean1_1828Help
Entry
Franean1_1828     CDS       T00608                                 

Definition
acylglycerol lipase (EC:3.1.1.23)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
fre  Frankia sp. EAN1pec
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(2193326..2194144)
Genome map
AA seq 272 aa AA seqDB search
MAGVPEPAILPGAEPFDLDGGGGDGAGVLLVHGFTGSPQSMRLWGDHLTAAGLRVSCPRL
PGHGTRWQDMTTTTWQDWYGAADAAFGRLSASCDRVFVMGLSMGATLTLRLAEEHSDKVA
GAVTVNASLGTDRRTAALAPLLWRILPTVPGVANDIRDPAATEVGYSRVPTRAFASLREL
WAVTLADLGRVVCPVLAYRSVTDHVVEPTSGRLLLAGLTSAPAEERLLHSSYHVATLDHD
KETIFKGSIDFVTATPGPAGSGQPEPRPGRHA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggcgggagtcccggagccggcgatcctgcccggcgccgagcccttcgatctcgacggc
ggtggtggcgacggcgcgggtgtgctgctcgtgcacggcttcaccggctcgccgcagagc
atgcgactgtggggcgatcatctcaccgcggccggcctgcgcgtgagctgcccgcggctg
cccggccacggcacccggtggcaggacatgaccaccacgacctggcaggactggtacggc
gccgcggacgcggccttcggccggctgagcgcctcctgcgaccgggtcttcgtcatgggc
ctgtcgatgggcgcgacgctcacgctgcgcctcgccgaggagcacagcgacaaggtcgcg
ggagcggtcaccgtcaacgccagcctcggcacggaccggcggacggccgcgctggcgccg
ctgctgtggcggatcctgccgacggtgcccggggtcgcgaacgacatccgtgatcccgcc
gcgacggaggtcggctactcgcgtgttccgaccagggcgttcgcctcgctgcgcgagctg
tgggcggtgaccctggcggacctcggccgggtggtgtgcccggtgctggcctaccggagc
gtgaccgatcatgtggtcgagccgacgtccgggcgcctgctgctcgcgggtctcacgtcc
gcgcccgccgaggaacggctgctgcactccagctaccacgtggccaccctcgaccacgac
aaggaaacgatcttcaaggggagcatcgacttcgtcaccgcgacgccggggccggccggc
tccggccagcccgagccgaggccgggccgtcatgcctga

DBGET integrated database retrieval system