KEGG   Frankia sp. EAN1pec: Franean1_1828Help
Entry
Franean1_1828     CDS       T00608                                 

Definition
(GenBank) Acylglycerol lipase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
fre  Frankia sp. EAN1pec
Brite
Enzymes [BR:fre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Franean1_1828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Peptidase_S9 Esterase_phd Abhydrolase_2 Abhydrolase_3 BAAT_C DLH
Motif
Other DBs
NCBI-ProteinID: ABW11266
RhizoBase: Franean1_1828
UniProt: A8LFG3
Position
complement(2193326..2194144)
Genome map
AA seq 272 aa AA seqDB search
MAGVPEPAILPGAEPFDLDGGGGDGAGVLLVHGFTGSPQSMRLWGDHLTAAGLRVSCPRL
PGHGTRWQDMTTTTWQDWYGAADAAFGRLSASCDRVFVMGLSMGATLTLRLAEEHSDKVA
GAVTVNASLGTDRRTAALAPLLWRILPTVPGVANDIRDPAATEVGYSRVPTRAFASLREL
WAVTLADLGRVVCPVLAYRSVTDHVVEPTSGRLLLAGLTSAPAEERLLHSSYHVATLDHD
KETIFKGSIDFVTATPGPAGSGQPEPRPGRHA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggcgggagtcccggagccggcgatcctgcccggcgccgagcccttcgatctcgacggc
ggtggtggcgacggcgcgggtgtgctgctcgtgcacggcttcaccggctcgccgcagagc
atgcgactgtggggcgatcatctcaccgcggccggcctgcgcgtgagctgcccgcggctg
cccggccacggcacccggtggcaggacatgaccaccacgacctggcaggactggtacggc
gccgcggacgcggccttcggccggctgagcgcctcctgcgaccgggtcttcgtcatgggc
ctgtcgatgggcgcgacgctcacgctgcgcctcgccgaggagcacagcgacaaggtcgcg
ggagcggtcaccgtcaacgccagcctcggcacggaccggcggacggccgcgctggcgccg
ctgctgtggcggatcctgccgacggtgcccggggtcgcgaacgacatccgtgatcccgcc
gcgacggaggtcggctactcgcgtgttccgaccagggcgttcgcctcgctgcgcgagctg
tgggcggtgaccctggcggacctcggccgggtggtgtgcccggtgctggcctaccggagc
gtgaccgatcatgtggtcgagccgacgtccgggcgcctgctgctcgcgggtctcacgtcc
gcgcccgccgaggaacggctgctgcactccagctaccacgtggccaccctcgaccacgac
aaggaaacgatcttcaaggggagcatcgacttcgtcaccgcgacgccggggccggccggc
tccggccagcccgagccgaggccgggccgtcatgcctga

DBGET integrated database retrieval system