KEGG   Frankia sp. EAN1pec: Franean1_1931Help
Entry
Franean1_1931     CDS       T00608                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
fre  Frankia sp. EAN1pec
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:fre01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:fre00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
2313797..2314603
Genome map
AA seq 268 aa AA seqDB search
MNALEEILDGVRADLAVRERETSLAALKQRVERVPDPRDALAVLRAPRVSVIAEIKRRSP
SRGALATIADPAALASLYEQAGAAAVSVLTEQRRFGGSLADLDAVRVAVDIPVLRKDFVI
SPYQVLEARAHGADMVLLIVAALDQPRLIGLLERVESLGMTALVEVHDETEMLRALDAGA
RLVGVNARNLRTLEVDRETFARLAPMVPQGVLKVAESGVRGPRDLLQYAGAGADAVLVGE
AAVTGGDPRQFVADLVTAGTHPATRIAH
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctctcgaggagatcctcgacggggtcagagcagatctggccgtccgtgagcgg
gaaacgtccctggcagctctgaaacaacgtgttgagcgtgtacccgatccccgggacgcg
ctggcggtgctgcgcgcaccgcgggtttcggtgatcgcggagatcaagcgccgctcgccg
tccaggggtgcgctcgcgacgatcgccgatccggcggcgctcgcctcgctctacgagcag
gcgggcgccgcggcggtcagcgtcctcaccgagcagcggcggttcggcggctcgctggcc
gatctggacgccgtccgggtggccgtcgacatccccgtcctgcgcaaggacttcgtgatc
tcgccgtaccaggtcctcgaggcgcgggcgcatggcgccgacatggtcctgctgatcgtg
gccgcactcgatcagccgaggctgatcgggctgctcgagcgggtcgagtcgctgggcatg
accgcgctggtcgaggtgcacgacgagaccgagatgctgcgggcgctcgacgcgggcgcc
cggctggtcggggtcaacgcccgcaacctgcgcaccctcgaggtggacagggagaccttc
gcccggctcgcgccgatggtcccgcagggggtgctgaaggtcgccgagtccggcgtgcgc
ggcccgcgcgacctgctccagtacgcgggtgccggggcggacgcggtgctggtcggggag
gccgccgtgaccggcggcgacccgcgccagttcgtcgccgatctcgtgaccgctggaacg
catcccgccacccgtatcgcgcactga

DBGET integrated database retrieval system