KEGG   Frankia sp. EAN1pec: Franean1_1932Help
Entry
Franean1_1932     CDS       T00608                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fre  Frankia sp. EAN1pec
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Franean1_1932
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Franean1_1932
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Franean1_1932
Enzymes [BR:fre01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Franean1_1932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
2314669..2316141
Genome map
AA seq 490 aa AA seqDB search
MLCVRSVSGRGPAPHVTSVGVGAGTVEAVTARSVDTTADPTSAIDPSRATDPSRATGPVE
VGTWSAAQAAGNWQAVPDAAGHYGRFGGRFVPEALFAALDELTAAYEAARVDPAFVDELD
RLLASYAGRPTPLTSADRLTERIGGARILLKREDLAHTGSHKINNVLGQCLLTRRMGKTR
VIAETGAGQHGVATATACALLGLECVVYMGEEDTRRQALNVARMRLLGAEVVPVASGSRT
LKDAINEAMRDWVATVDSTHYCIGSVMGPHPFPMMVRDFQRIIGVEARQQTLDLLGRLPD
AVVACVGGGSNAMGVFHRFIPDTEVALIGCEAGGDGVVTGRHAAAIAGGAPGVLHGMRTF
LLQDADGQTQVSHSISAGLDYPGIGPEHALLHETGRASYRVVDDSAAMEALALVARTEGI
LVAIESAHAFAGAFEVARELGPDAVVLVNCSGRGDKDVDTAARWFDLLDTDDTDAESRGE
GAAPATEPSA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
gtgctctgtgttcggagcgtctccgggcggggcccggccccgcacgtcacctcggtgggg
gtgggcgccggtacagtcgaggccgtgacagctcgatccgtcgacaccaccgccgacccg
acctccgccatcgatccgagccgtgccaccgacccgagccgcgcgaccggcccggtcgag
gtcggcacgtggtcggccgcccaggcggcggggaactggcaggccgtaccggatgccgcc
ggtcactacggccgtttcggcgggcggttcgtcccggaggcgctgttcgcggcgctcgac
gagctcaccgcggcctacgaggccgcccgggtcgaccccgccttcgtcgatgagctcgac
cgcctgttggcgagctacgccgggcgcccgacgccgctgacctcggccgaccggctcacg
gagcggatcggtggcgcgcgcatcctgctcaagcgcgaggatctcgcgcacaccggctca
cacaagatcaacaatgttctcgggcagtgcctcctcacccggcggatgggcaagacccgg
gtgatcgccgagaccggagccggtcagcacggcgtggccaccgccaccgcctgcgccctg
ctggggctggagtgcgtcgtctacatgggcgaggaggacactcgccggcaggcgctcaac
gtcgcccggatgcgcctgctcggtgccgaggtggtccccgtcgcgtcgggcagccgcacc
ctgaaggacgccatcaacgaggccatgcgcgactgggtggccaccgtcgactcgacccac
tactgcatcgggtccgtgatgggcccgcacccgttcccgatgatggtccgtgacttccag
cggatcatcggcgtggaggcgcgtcagcagacgctcgacctgctcggccgcctgcccgac
gccgtcgtcgcctgtgtcgggggcgggtcgaacgcgatgggcgtcttccaccgcttcatc
ccggacaccgaggtcgccctgattggctgcgaggccggcggcgacggagtggtgacgggc
cgccacgccgcggcgatcgccgggggcgcgcccggggtcctgcacggcatgcggaccttc
ctcctccaggacgcggacggccagacccaggtctcccattccatctcggccgggctcgac
tacccgggcatcggccctgagcacgccctcctgcacgagaccggccgggccagctaccgg
gtggtcgacgacagtgccgcgatggaggcactggcactggtcgcgcggacggagggcatc
ctcgtcgcgatcgagagcgcacacgccttcgccggcgcgttcgaggtggcccgtgagctc
ggcccggacgccgtcgtcctggtcaactgctccggccggggggacaaggacgtcgacacg
gccgcccgctggttcgatctgctggacacggacgacacggacgccgagtctcggggcgag
ggcgcagccccggccaccgaaccgtccgcctga

DBGET integrated database retrieval system