KEGG   Frankia sp. EAN1pec: Franean1_1932Help
Entry
Franean1_1932     CDS       T00608                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fre  Frankia sp. EAN1pec
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:fre01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:fre00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:fre00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
2314669..2316141
Genome map
AA seq 490 aa AA seqDB search
MLCVRSVSGRGPAPHVTSVGVGAGTVEAVTARSVDTTADPTSAIDPSRATDPSRATGPVE
VGTWSAAQAAGNWQAVPDAAGHYGRFGGRFVPEALFAALDELTAAYEAARVDPAFVDELD
RLLASYAGRPTPLTSADRLTERIGGARILLKREDLAHTGSHKINNVLGQCLLTRRMGKTR
VIAETGAGQHGVATATACALLGLECVVYMGEEDTRRQALNVARMRLLGAEVVPVASGSRT
LKDAINEAMRDWVATVDSTHYCIGSVMGPHPFPMMVRDFQRIIGVEARQQTLDLLGRLPD
AVVACVGGGSNAMGVFHRFIPDTEVALIGCEAGGDGVVTGRHAAAIAGGAPGVLHGMRTF
LLQDADGQTQVSHSISAGLDYPGIGPEHALLHETGRASYRVVDDSAAMEALALVARTEGI
LVAIESAHAFAGAFEVARELGPDAVVLVNCSGRGDKDVDTAARWFDLLDTDDTDAESRGE
GAAPATEPSA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
gtgctctgtgttcggagcgtctccgggcggggcccggccccgcacgtcacctcggtgggg
gtgggcgccggtacagtcgaggccgtgacagctcgatccgtcgacaccaccgccgacccg
acctccgccatcgatccgagccgtgccaccgacccgagccgcgcgaccggcccggtcgag
gtcggcacgtggtcggccgcccaggcggcggggaactggcaggccgtaccggatgccgcc
ggtcactacggccgtttcggcgggcggttcgtcccggaggcgctgttcgcggcgctcgac
gagctcaccgcggcctacgaggccgcccgggtcgaccccgccttcgtcgatgagctcgac
cgcctgttggcgagctacgccgggcgcccgacgccgctgacctcggccgaccggctcacg
gagcggatcggtggcgcgcgcatcctgctcaagcgcgaggatctcgcgcacaccggctca
cacaagatcaacaatgttctcgggcagtgcctcctcacccggcggatgggcaagacccgg
gtgatcgccgagaccggagccggtcagcacggcgtggccaccgccaccgcctgcgccctg
ctggggctggagtgcgtcgtctacatgggcgaggaggacactcgccggcaggcgctcaac
gtcgcccggatgcgcctgctcggtgccgaggtggtccccgtcgcgtcgggcagccgcacc
ctgaaggacgccatcaacgaggccatgcgcgactgggtggccaccgtcgactcgacccac
tactgcatcgggtccgtgatgggcccgcacccgttcccgatgatggtccgtgacttccag
cggatcatcggcgtggaggcgcgtcagcagacgctcgacctgctcggccgcctgcccgac
gccgtcgtcgcctgtgtcgggggcgggtcgaacgcgatgggcgtcttccaccgcttcatc
ccggacaccgaggtcgccctgattggctgcgaggccggcggcgacggagtggtgacgggc
cgccacgccgcggcgatcgccgggggcgcgcccggggtcctgcacggcatgcggaccttc
ctcctccaggacgcggacggccagacccaggtctcccattccatctcggccgggctcgac
tacccgggcatcggccctgagcacgccctcctgcacgagaccggccgggccagctaccgg
gtggtcgacgacagtgccgcgatggaggcactggcactggtcgcgcggacggagggcatc
ctcgtcgcgatcgagagcgcacacgccttcgccggcgcgttcgaggtggcccgtgagctc
ggcccggacgccgtcgtcctggtcaactgctccggccggggggacaaggacgtcgacacg
gccgcccgctggttcgatctgctggacacggacgacacggacgccgagtctcggggcgag
ggcgcagccccggccaccgaaccgtccgcctga

DBGET integrated database retrieval system