KEGG   Frankia sp. EAN1pec: Franean1_1932Help
Entry
Franean1_1932     CDS       T00608                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fre  Frankia sp. EAN1pec
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Franean1_1932
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Franean1_1932
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Franean1_1932
Enzymes [BR:fre01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Franean1_1932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
2314669..2316141
Genome map
AA seq 490 aa AA seqDB search
MLCVRSVSGRGPAPHVTSVGVGAGTVEAVTARSVDTTADPTSAIDPSRATDPSRATGPVE
VGTWSAAQAAGNWQAVPDAAGHYGRFGGRFVPEALFAALDELTAAYEAARVDPAFVDELD
RLLASYAGRPTPLTSADRLTERIGGARILLKREDLAHTGSHKINNVLGQCLLTRRMGKTR
VIAETGAGQHGVATATACALLGLECVVYMGEEDTRRQALNVARMRLLGAEVVPVASGSRT
LKDAINEAMRDWVATVDSTHYCIGSVMGPHPFPMMVRDFQRIIGVEARQQTLDLLGRLPD
AVVACVGGGSNAMGVFHRFIPDTEVALIGCEAGGDGVVTGRHAAAIAGGAPGVLHGMRTF
LLQDADGQTQVSHSISAGLDYPGIGPEHALLHETGRASYRVVDDSAAMEALALVARTEGI
LVAIESAHAFAGAFEVARELGPDAVVLVNCSGRGDKDVDTAARWFDLLDTDDTDAESRGE
GAAPATEPSA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
gtgctctgtgttcggagcgtctccgggcggggcccggccccgcacgtcacctcggtgggg
gtgggcgccggtacagtcgaggccgtgacagctcgatccgtcgacaccaccgccgacccg
acctccgccatcgatccgagccgtgccaccgacccgagccgcgcgaccggcccggtcgag
gtcggcacgtggtcggccgcccaggcggcggggaactggcaggccgtaccggatgccgcc
ggtcactacggccgtttcggcgggcggttcgtcccggaggcgctgttcgcggcgctcgac
gagctcaccgcggcctacgaggccgcccgggtcgaccccgccttcgtcgatgagctcgac
cgcctgttggcgagctacgccgggcgcccgacgccgctgacctcggccgaccggctcacg
gagcggatcggtggcgcgcgcatcctgctcaagcgcgaggatctcgcgcacaccggctca
cacaagatcaacaatgttctcgggcagtgcctcctcacccggcggatgggcaagacccgg
gtgatcgccgagaccggagccggtcagcacggcgtggccaccgccaccgcctgcgccctg
ctggggctggagtgcgtcgtctacatgggcgaggaggacactcgccggcaggcgctcaac
gtcgcccggatgcgcctgctcggtgccgaggtggtccccgtcgcgtcgggcagccgcacc
ctgaaggacgccatcaacgaggccatgcgcgactgggtggccaccgtcgactcgacccac
tactgcatcgggtccgtgatgggcccgcacccgttcccgatgatggtccgtgacttccag
cggatcatcggcgtggaggcgcgtcagcagacgctcgacctgctcggccgcctgcccgac
gccgtcgtcgcctgtgtcgggggcgggtcgaacgcgatgggcgtcttccaccgcttcatc
ccggacaccgaggtcgccctgattggctgcgaggccggcggcgacggagtggtgacgggc
cgccacgccgcggcgatcgccgggggcgcgcccggggtcctgcacggcatgcggaccttc
ctcctccaggacgcggacggccagacccaggtctcccattccatctcggccgggctcgac
tacccgggcatcggccctgagcacgccctcctgcacgagaccggccgggccagctaccgg
gtggtcgacgacagtgccgcgatggaggcactggcactggtcgcgcggacggagggcatc
ctcgtcgcgatcgagagcgcacacgccttcgccggcgcgttcgaggtggcccgtgagctc
ggcccggacgccgtcgtcctggtcaactgctccggccggggggacaaggacgtcgacacg
gccgcccgctggttcgatctgctggacacggacgacacggacgccgagtctcggggcgag
ggcgcagccccggccaccgaaccgtccgcctga

DBGET integrated database retrieval system