KEGG   Frankia sp. EAN1pec: Franean1_1933Help
Entry
Franean1_1933     CDS       T00608                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
fre  Frankia sp. EAN1pec
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Franean1_1933
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Franean1_1933
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Franean1_1933
Enzymes [BR:fre01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Franean1_1933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
RhizoBase: 
UniProt: 
Position
2316180..2317100
Genome map
AA seq 306 aa AA seqDB search
MAHDQSAQQAWAQEQPARDQPAPSRLEPSGQRPARRGGPSPLDEAFAAARKDGRAVLVGY
LPAGFPTVDRGIAAMRAMVAAGVDVVEVGLPYSDPTMDGPVIQDAADTALRGGVTTRDVL
RTVEAVAETGAPTLVMTYWNPVERYGMEAFAADLAAAGGAGAITPDLPPEEAGPWLAASA
THGLDPVFLVAPSSTTERLRLVTAHSGGFVYAASTMGVTGARAAVGVKAAGLVARVREVT
DLPVAVGLGVSTGAQASEVAGFADGVIVGSALVRALAADARDGADGVGAIERLAAELAAG
VRSATA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcacgaccagtcggcccagcaggcatgggcccaggagcagccggcgcgcgaccag
ccggcgccgagccggctcgagccgtccgggcagcggccggcccggcgcggcgggccgagc
ccgctggacgaggccttcgcggccgcgcgcaaggacgggcgggcggtgctcgtcggctat
ctccccgccgggttcccgacggtggaccgcggcatcgcggcgatgcgggcgatggtcgcg
gcgggcgtggacgtcgtcgaggtcggcctgccctactcggatccgacgatggacggcccg
gtcatccaggacgccgcggacaccgcgctgcgcggcggcgtgaccaccagggacgtgctg
cgcacggtcgaggcggtcgccgagaccggggcccccaccctggtgatgacctactggaac
ccggtggagcggtacggcatggaggcgttcgccgccgacctggccgccgccggcggggcc
ggggcgatcacccccgacctgccgccggaggaggccggcccgtggctcgcggccagcgcc
acccacggcctcgacccggtcttcctggtcgcgccgagctcgaccaccgaacggctgcgc
ctggtgacggcgcacagcggcggcttcgtctacgcggcgtcgaccatgggcgtcaccggt
gcgcgcgccgccgtcggtgtgaaggcggccggcctggtcgcccgggtccgggaggtgacc
gacctgcctgtggcggttggcctcggcgtcagcaccggtgctcaggcgtccgaggtggcc
ggcttcgccgacggcgtcatcgtgggctcggcgctggtccgggccctggcggccgacgcg
cgggacggcgccgacggcgtcggtgcgatcgagcggctggcggctgagctcgccgccggc
gtgcgttcggccaccgcctga

DBGET integrated database retrieval system