KEGG   Frankia sp. EAN1pec: Franean1_2065Help
Entry
Franean1_2065     CDS       T00608                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fre  Frankia sp. EAN1pec
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Franean1_2065 (tpiA)
   01230 Biosynthesis of amino acids
    Franean1_2065 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Franean1_2065 (tpiA)
   00051 Fructose and mannose metabolism
    Franean1_2065 (tpiA)
   00562 Inositol phosphate metabolism
    Franean1_2065 (tpiA)
Enzymes [BR:fre01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Franean1_2065 (tpiA)
Exosome [BR:fre04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Franean1_2065 (tpiA)
  Exosomal proteins of bladder cancer cells
   Franean1_2065 (tpiA)
  Exosomal proteins of melanoma cells
   Franean1_2065 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
2488987..2489799
Genome map
AA seq 270 aa AA seqDB search
MAKGAPARGSAGTGRRTLVAGNWKMNLNHLEAIALVQKVAFDLKPAELERVEVVFLPPFT
DLRSVQTLIDGDKLAVGYGGQDLSPHGSGAYTGDISGPMLARLGCSYVVVGHSERRTYHH
EDDALVASKVLAAYKHGITPILCVGEHEDIRAAGTHVEHVLAQLEGSLAGVSAEQAATLV
VAYEPVWAIGTGRTASAQDAQDMCAAVRGQLTKLYDEPIAAGIRVLYGGSVKAANAAELF
TMPDVDGGLVGGASLVAEEFVGIIRSGPAA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaagggggcacccgcccgcgggtcggccggaaccggccggcggacgctggtcgcc
ggcaactggaagatgaacctcaaccacctcgaggccatcgcgctggtgcagaaggtcgcc
ttcgacctcaagcccgccgagctcgagcgggtcgaggtcgtcttcctgccgccgttcacc
gacctgcgcagcgtccagacgctgatcgacggcgacaagctcgccgtcggctacggcggc
caggatctctccccgcacggctcgggcgcctacaccggcgacatcagcgggccgatgctg
gccaggctcggctgctcgtacgtcgtcgtcgggcactccgagcggcgcacgtaccaccac
gaggacgacgcgctggtcgcctcgaaggtcctggcggcctacaaacacggcatcacgccg
atcctgtgtgtcggcgagcacgaggacatccgcgccgcgggaacccatgtcgagcacgtc
ctggcgcagctcgagggctcgctggccggcgtgagcgcggagcaggcggccacgctcgtc
gtcgcctacgagccggtctgggcgatcggtaccgggcgcaccgcatccgcccaggacgcg
caggacatgtgcgccgccgtccgcggccagctgacgaagctgtacgacgagccgatcgcg
gccggcatccgggtcctctacggcggctcggtgaaggccgccaacgcggccgagctgttc
accatgcccgacgtggacggcggtctggtcggcggtgcgagcctggtcgccgaggagttc
gtcggcatcatccgcagcggtccggcggcgtag

DBGET integrated database retrieval system