KEGG   Frankia sp. EAN1pec: Franean1_2082Help
Entry
Franean1_2082     CDS       T00608                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
fre  Frankia sp. EAN1pec
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:fre00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(2507352..2508845)
Genome map
AA seq 497 aa AA seqDB search
MLVAAVDQGTTGTTVCLLDEEATVVGRGYRAVGTSFPRPGWVEQDPAELLRGVVDTVAAA
LADAGRAPSDLAAVGITNQRETTVLWERRTGHPLHPAVVWQDRRTADVCERLAAAGHGPR
VQERTGLVLDPYFSGTKAAWVLDHVDGARRAAAAGEIAFGTVDSWLVWGLTGGRAHITDV
TNASRTMLFDLADGAWSAEMCDLLDVPAELLAEVVPSSRVYAETDPEVFLGVRVPIAAVV
GDQQAALFAQACFEPGQAKNTYGTGSFVLVNTGATLPAPQSSLLRTVAFGLDGEPLTYAL
EGAILSTGSAVQWLRDGLGVISDAEQTAALAASLDGNDGVYFVPALAGLGAPHWDPRARG
TLVGLTRATGRAHLARAVLEGIAYQTRDVVEEMAAGAGVTVTQLRADGGAARNPWLMQFQ
ADILGVEVDVPENIETTALGSGYLAGLATGVYAGRDELDARRRTAARYQPAMDEDQRAEL
YGQWLRAVELSRDWDRG
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgctggtagccgccgtcgatcagggcacgacagggaccacggtctgcctgctcgacgag
gaggccacggtcgtcggccgcggctaccgcgcggtcggcacctccttcccccgcccgggc
tgggtggagcaggacccggcggagctgctgcgcggcgtcgtcgacaccgtcgccgccgcg
ctggccgacgccgggcgggccccgtccgacctggcagcggtgggcatcaccaaccagcgc
gagaccacggtcctctgggaacgccgcaccggacatccactgcaccccgccgtggtctgg
caggaccggcgcacggcggatgtctgcgaacggctggccgcggccggccacgggccgcgg
gtccaggagcgcaccggcctggtgctcgacccctatttctccgggacgaaggccgcctgg
gtgctcgaccacgtcgacggggcccgccgggcggccgcggccggcgagatcgcgttcggc
accgtcgactcctggctcgtctggggcctgaccggcgggcgggcgcacatcaccgatgtc
accaacgcctcccgcacgatgctgttcgacctggcggacggcgcctggtcggccgagatg
tgcgacctgctggacgtcccggccgagctgctcgccgaggtggtgccgagctcccgggtg
tacgccgagaccgacccggaggtgttcctcggggtccgggtgccgatcgccgcggtcgtc
ggcgaccagcaggccgccctgttcgcgcaggcgtgcttcgagcccggccaggccaagaac
acctacggcaccggctcgttcgtcctggtcaacaccggggcgacgctcccggcgccgcag
tcgtcgctgctgcgcactgtcgcgttcgggctcgacggcgagccgctcacctacgcgctg
gagggggcgatcctctccaccggctccgcggtgcagtggctgcgtgacgggctgggcgtc
atctccgacgccgagcagaccgcggcgctggccgcctcgctggacggcaacgacggggtg
tacttcgtccccgcgctcgccgggctcggcgcgccgcactgggacccgcgcgcccggggc
acgctggtcggcctgacccgggcgaccggccgggcgcacctggcccgcgcggtgctcgag
ggcatcgcctaccagaccagggacgtcgtcgaggagatggccgcgggcgccggggtgacg
gtgacccagctgcgggcggacggcggcgccgcgcgcaacccgtggctgatgcagttccag
gccgacatcctcggggtcgaggtggacgtcccggagaacatcgagaccacggcgctgggg
tcgggctacctggccgggctggcgaccggtgtctacgccgggcgcgacgagctggacgcc
cggcgacgcaccgcggcgcggtaccagccggccatggacgaagaccagcgagccgagctt
tacgggcagtggctgcgcgccgtcgagctctcacgggactgggatcgcggctga

DBGET integrated database retrieval system