KEGG   Frankia sp. EAN1pec: Franean1_2426Help
Entry
Franean1_2426     CDS       T00608                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fre  Frankia sp. EAN1pec
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Franean1_2426
   01230 Biosynthesis of amino acids
    Franean1_2426
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Franean1_2426
   00030 Pentose phosphate pathway
    Franean1_2426
   00051 Fructose and mannose metabolism
    Franean1_2426
   00052 Galactose metabolism
    Franean1_2426
  Energy metabolism
   00680 Methane metabolism
    Franean1_2426
Enzymes [BR:fre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Franean1_2426
Protein phosphatases and associated proteins [BR:fre01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Franean1_2426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
2887303..2888640
Genome map
AA seq 445 aa AA seqDB search
MDEPLTVDGAELDVRKLGPCRIDSPLLPLLGARPTTQHYIDEGDKVLFDDTVSMISARKV
PLDELPGFEPAGPRRKIYFDPSKTRVGIVTCGGLCPGLNNVIRGLVLELTNHYGVNRIFG
FRHGYQGFIAKYGHSVVDLTPERVANIDEDGGTILGTSRGQQDPAEIVDCLSRMNINILF
VIGGDGTLRGARAIAGIVAERGEKIAVVGIPKTIDNDIPYIDQSFGFQTAFAKAAESIRA
AYAEATSAPGGVGIVRLMGRHSGFIACYAVLAKSDADVVLIPELPFTLEGERGLLAYIRQ
RVEKRGHAVVVVAEGAGQDLVAGLPESSDASGNRKLYDIGPELSRRITEDFAARGAELNL
KYIDPSYHIRSVAANPYDNVYTIRLAHAAVHAAMSGRTEMVVGRWRRRFIHIPIALAVSQ
RNQVDPAGDLWMSVLEATGQPYRFG
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
gtggacgagccgctgaccgtcgacggcgccgagttggatgtccgcaagctcggcccgtgc
cggatcgactcgccgctgctcccgttgctcggtgcgcggccgacgacccagcactacatc
gacgagggcgacaaggtcctcttcgacgacaccgtttcgatgatctccgcgcggaaggtg
ccgctggacgagctgccgggcttcgagcccgccgggccgcgccgcaagatctactttgac
ccgtccaagacccgggtggggatcgtgacctgcggggggctctgccccggcctgaacaac
gtcatccgcgggctggtgctcgagctgaccaaccactacggcgtgaaccggatcttcggg
ttccggcacggctaccagggtttcatcgccaagtacgggcacagcgtcgtcgacctcacc
ccggagcgggtggcgaacatcgacgaggacggcggcacgatcctcggcacctcccgcggc
caacaggacccggcagagatcgtcgactgcctttcccggatgaacatcaacatcctgttc
gtgatcggcggtgacggcacgctgcgcggtgcgcgggcgatcgccggcatcgtcgccgag
cgcggggagaagatcgcggtcgtcggcatcccgaagacgatcgacaacgacatcccctac
atcgaccagagcttcgggttccagaccgcgttcgcgaaggccgccgagtcgatccgcgcc
gcgtacgccgaggcgacctcggctcccggcggggtcggtattgtccggctgatgggccgc
cactccggcttcatcgcctgttacgcggtgctggccaagagcgatgcggacgtcgtgctc
atcccggagctgcccttcaccctggagggggagcggggcctgctcgcctacatccgtcag
cgggtcgagaagcggggccatgccgtcgtcgtcgtggcggagggcgccgggcaggacctg
gtcgccggcctgcccgagtcgtccgacgcctcggggaaccgcaagctctacgacatcggc
ccggagctctcccggcggatcaccgaggatttcgccgcccgcggcgccgagctcaacttg
aagtacatcgacccgagctaccacatccgcagcgtggcggcgaacccgtacgacaacgtc
tacacgatccggctggcgcacgcggcggtccacgccgcgatgtccgggcgcacggagatg
gtcgtcgggcgctggcgccgccggttcatccacatcccgatcgcgcttgccgtcagccag
cgcaaccaggtcgacccggccggtgatctgtggatgtcggtcctggaggccaccggccag
ccctaccgcttcggctga

DBGET integrated database retrieval system