KEGG   Frankia sp. EAN1pec: Franean1_2883Help
Entry
Franean1_2883     CDS       T00608                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
fre  Frankia sp. EAN1pec
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:fre00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:fre00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:fre00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:fre00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:fre00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(3398701..3399675)
Genome map
AA seq 324 aa AA seqDB search
MATATSGTGKTKVAVIGSGNIGTDLMIKILRTSEVLEIAAMVGIDAESDGLARARRLKVA
TTHEGIDGLLRMPEFDDIEIVFDATSAGAHARNDELLRARGRRVIDLTPAAIGPYVVPPV
NLDAHLDAPNINMVTCGGQATIPIVAAVNAVTPVAYAEIVASIASKSAGPGTRANIDEFT
ETTASAIEKVGGAARGKAIIVLNPAEPPLVMRDTVYCLIGASDQATQDAVVASVTRMVDR
VREYVPGYRLKQQVQIEEASADDPLRQLAPDGSEPAKVTVFLEVTGAAHYLPAYAGNLDI
MTSAALRAGERLAQTLTQREGATA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
ttggccaccgccaccagcggaaccggaaagacgaaggtcgccgtcatcggctcggggaat
atcggcaccgacctgatgatcaagatcctccggacctccgaggttctggaaatcgccgcg
atggtcggcatcgacgccgaatccgacgggctggcccgcgcccgccggctcaaggtcgcg
accacccatgagggcatcgacgggttgctgcggatgccggagttcgacgacatcgagatc
gtcttcgacgccacgtccgccggcgcgcacgcccgcaacgacgagctgctgcgtgcccgc
ggccgccgggtcatcgatctgaccccggccgcgatcgggccgtacgtggtgccgccggtc
aacctggacgcccacctggacgcccccaacatcaacatggtgacctgcggcgggcaggcg
acgatcccgatcgtcgcggccgtcaacgccgtcaccccggtggcctacgccgagatcgtc
gcgtccatcgcgtcgaagtcggcagggccgggcacccgggcgaacatcgacgagttcact
gagaccacggccagcgccatcgagaaggtcggcggtgccgcccgcggcaaggccatcatc
gtgctgaacccggccgagccgccgctggtcatgcgcgacaccgtgtactgcctgatcggc
gcctccgaccaggccacccaggacgccgtcgtcgcctcggtgacccggatggtcgaccgg
gtgcgcgagtacgtcccgggctacaggctcaagcagcaggtgcagatcgaggaggcgtcg
gcggacgatccactgcgccagctcgcgccggacgggtccgaacccgccaaggtcacggtg
ttcctggaggtcaccggtgccgcgcactacctgcccgcctatgccggcaacctcgacatc
atgacctcggccgcgctgcgtgccggggagcgcctggcacagaccctcacccagcgggaa
ggagcgaccgcctga

DBGET integrated database retrieval system