KEGG   Frankia sp. EAN1pec: Franean1_2944Help
Entry
Franean1_2944     CDS       T00608                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
fre  Frankia sp. EAN1pec
Pathway
fre00071  Fatty acid degradation
fre00280  Valine, leucine and isoleucine degradation
fre00281  Geraniol degradation
fre00310  Lysine degradation
fre00362  Benzoate degradation
fre00380  Tryptophan metabolism
fre00410  beta-Alanine metabolism
fre00640  Propanoate metabolism
fre00650  Butanoate metabolism
fre00903  Limonene and pinene degradation
fre00930  Caprolactam degradation
fre01040  Biosynthesis of unsaturated fatty acids
fre01100  Metabolic pathways
fre01110  Biosynthesis of secondary metabolites
fre01120  Microbial metabolism in diverse environments
fre01130  Biosynthesis of antibiotics
fre01200  Carbon metabolism
fre01212  Fatty acid metabolism
Module
fre_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Franean1_2944
   00650 Butanoate metabolism
    Franean1_2944
  Lipid metabolism
   00071 Fatty acid degradation
    Franean1_2944
   01040 Biosynthesis of unsaturated fatty acids
    Franean1_2944
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Franean1_2944
   00310 Lysine degradation
    Franean1_2944
   00380 Tryptophan metabolism
    Franean1_2944
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Franean1_2944
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Franean1_2944
   00281 Geraniol degradation
    Franean1_2944
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Franean1_2944
   00930 Caprolactam degradation
    Franean1_2944
Enzymes [BR:fre01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Franean1_2944
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Franean1_2944
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Franean1_2944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DAO AlaDh_PNT_C NAD_binding_2 Shikimate_DH Thi4 GIDA
Motif
Other DBs
NCBI-ProteinID: ABW12364
RhizoBase: Franean1_2944
UniProt: A8LAG2
Position
3463496..3465670
Genome map
AA seq 724 aa AA seqDB search
MSDASTGQSMIRWEQRPNGVVVLTIDDPTQSVNTMNALYTSAMNTVVGRLYAEKDSVTGV
ILTSAKKSFFAGGDIDLMIAATDAAALFAEIEQMKGPLRRLELLGRPVVAAINGAALGGG
LEIALACHHRVALDARSSRIGLPEVTLGLIPGGGGINRTVRMLGLQKALTQVLLSGQQYS
PAQALALGLVDDVVATPEEMMAAAEAWILANPDAAQPWDRKGFKIPGGTPASPALAASLP
SFPATLRKQLKGANYPAPKAILAAAVEGTQVDIDSALRVESSYLTSIILDPAAKNMMQVF
FLDKRAIDAGASRPAGFPRHAASKVLVLGAGMMGAGIAYMCAQAGLQVVLRDLSVSAAEK
GKAYSAGLVAKAVAKGRLSQEKADALLDRILATDSIDDAAGADLVIEAVFEDPALKQKLF
AEIESVVAPDAVLGSNTSTLPITMLAEGVQRQDSFIGLHFFSPVDKMPLLEIVVGGKTSD
ATLAKAFDIALQIRKTPIVVNDSRGFFTSRVIGKFLDEAIAMVGEGVDPASVEQAGLQAG
YPAAPLALYDELTLTLPRKIREETKAAALAEGAMWQEHGSESVVDRMIDEFDRKGRSTGG
GFYDYADGRRVGLWPGLREHFTRAGHTIPFEDMKERMLFAETIDTIRCFDEGVLRSVADA
NIGSILGIGYPSWTGGVLQYVNTYPGGASGFLARARELARLYGPRFEAPQSLIRLAAADG
QYRD
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgcgagcaccggccagtcaatgattcgttgggagcagcgcccgaacggcgtc
gtcgtcctgaccatagacgacccgacgcagagcgtgaacacgatgaacgcgctctacacg
tccgccatgaacaccgtcgtgggcaggctgtacgccgagaaggactcggtaaccggggtg
atcctcacatcggccaagaagagctttttcgcgggcggcgacatagacctcatgattgcc
gcgaccgacgcggcggccctcttcgccgaaatcgaacagatgaaaggccccctgcgcagg
ctcgaacttctcggccgcccggtcgtggcggcgatcaacggcgccgccctcggtggcggt
ctggagatcgcgctcgcctgccaccatagagtcgccctcgacgcgaggagctccaggatc
ggcctcccggaggtgaccctcgggctcatccccggtggtggcggcatcaaccgcaccgtg
cgcatgctcggactgcagaaggcactcacgcaggtgctgctgtccggccagcagtacagc
ccggcgcaggcactggcccttggcctggtcgacgacgtggtcgccacaccagaggagatg
atggcggccgccgaggcgtggatcctggccaatcccgatgcggcacagccgtgggaccgc
aagggcttcaagattcccggcggaacgccggccagcccggcgctggccgcgagcctgcca
tccttccccgccaccctgcgcaagcagctcaagggcgcgaactatccggcgcccaaggcc
atcctggccgctgccgtggagggcacgcaggtcgacatcgactccgcgctgcgggtggag
agcagctacctgacgagcatcattctcgacccagcggcgaagaacatgatgcaggtgttc
ttcctggacaagcgggcgatcgacgccggtgccagccggccggcgggcttcccccggcat
gcggcgtccaaggtgctggtgctgggggccgggatgatgggcgccggcatcgcgtacatg
tgcgcgcaggccggcctacaggtggtactcagggacctctcggtcagcgcggcggagaag
ggcaaggcgtactcggccggtctggtggccaaggcggttgccaagggccgcctgtcgcag
gagaaggccgacgccctgctggatcggatcctggcgacggacagcatcgacgacgccgcc
ggcgcggacctggtgatcgaggccgtgttcgaggatccggcgctgaagcagaagctattc
gccgagatcgaatccgtcgtggcaccggacgcggtactggggtcaaacacctcgacgctg
cccatcacgatgctggccgagggagtgcagcggcaggacagcttcatcgggctccacttc
ttctcaccggtggataagatgccgctgctcgagatcgtcgtgggtgggaagaccagcgac
gcgacgctcgccaaggcgttcgacatcgcgttgcagatccgtaagacaccgatcgtcgta
aacgacagccgtgggttcttcaccagccgggtcatcggcaagttccttgacgaggcgatc
gccatggtgggggagggcgtcgacccggcatccgtcgagcaggccggtctgcaggccggc
taccccgcggcaccgctcgccctctacgacgagctcacgctgaccctgccgcgcaagatc
cgcgaggagacgaaggcggcggccttggccgagggcgccatgtggcaggaacacggctcc
gagtccgtcgtcgaccggatgatcgacgagttcgaccgcaagggccgctccaccggcggc
ggattctacgactatgccgacggcagacgggttggcctgtggcccgggctgcgggagcac
ttcactagggccggtcacacgatccccttcgaggacatgaaggagcggatgctcttcgcc
gagacgatcgacacgatccgctgtttcgacgagggagtgctgcgctccgtcgcggacgcg
aacatcggctcgatcctggggatcggctacccctcctggaccggcggggttctccagtac
gtcaacacctatccgggaggggccagcggcttcctagcccgcgcccgggaacttgccagg
ctctacggcccccgcttcgaggccccacagagtctgatccgccttgccgcggccgacggc
cagtaccgagactga

DBGET integrated database retrieval system