KEGG   Frankia sp. EAN1pec: Franean1_3235Help
Entry
Franean1_3235     CDS       T00608                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
fre  Frankia sp. EAN1pec
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Franean1_3235
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Franean1_3235
   00620 Pyruvate metabolism
    Franean1_3235
   00640 Propanoate metabolism
    Franean1_3235
  Energy metabolism
   00680 Methane metabolism
    Franean1_3235
Enzymes [BR:fre01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Franean1_3235
Lipid biosynthesis proteins [BR:fre01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Franean1_3235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(3823046..3824638)
Genome map
AA seq 530 aa AA seqDB search
MVDPASRTAQLVRSYSAPTLDVAQLVCDRHPGHAVAARVLDDDLSETTVTYADLAKSSRR
FATVLSARGIGRGDRVATLMGKSVDLLTVLVGTWRVGAVYVPLFTAFAETAVTDRLRRAQ
ARLVVADTDQLPKIDQGPWEILPVERLAVEVAQAAPWEPGSVAVGGSGALVHMFTSGTTG
SPKGVVHPARYIGGWHSYQEFGLGVDTDSVYWSAADPGWAYGLYTAVVAPLAAGVPTILL
RGGFSADTTLRLLAELKVTNFAAAPTAYRGLRNSGRLEAGALSVPYLSSAGEPLTPDVNA
WAPEALGSRVHDHYGQTEIGMPIGFPHHEAVSVPVVDGAMGVALPGWSVTVLDPDHDEPA
DLGTIGRLAVVVANSPHMTFAAYADGDDHGRLVGDGRYYVTGDTATIDAAGVVRFSARDD
DVIIMAGYRIGPFDVESVLAQHPAVAECAVIAAPDEARGEVVEAYVVTTAASAVTEEELR
QWVKERYAAHAYPRRVHFVPSLPKTPSGKIQRNELRRRRRAEILGGRGFR
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggtcgatccggcatcgcgcaccgcgcagttggtgcgaagctattcggcgcccacgctg
gatgtcgcccagttagtgtgtgatcgccatccgggccatgcggtcgcggcgcgagtgctc
gacgatgatctgtcggagaccacagtcacctacgcggacctggccaagtcgtcgcggcgg
ttcgccaccgtgctcagtgcccgtggcatcgggcgcggtgaccgggtcgcgacgctgatg
ggcaagagcgtcgacctactcaccgtgctggtggggacctggcgagtgggcgccgtgtac
gtcccgctgttcaccgcgttcgccgagaccgcggtgaccgatcggctgcggcgcgcacag
gcccgcctggtcgtcgcggacaccgatcagctgcccaagatcgaccagggcccctgggag
atactcccggtcgagcgactggcggtcgaggtggcgcaggcagccccgtgggaaccgggc
tcggtcgcggtcggcggatccggcgcgctggtgcacatgttcacctccggcaccaccgga
tccccgaagggcgtcgtgcatccggcgcggtacatcggcggctggcacagctatcaggag
ttcggactcggcgtcgacacggacagcgtgtactggtccgccgccgaccccggctgggcc
tacggcctctacaccgcggtcgtcgcgccgctggccgccggagtcccgacgatcctgctg
cggggaggattctccgcggacaccacgctgcggctgctcgcggagctgaaggtgaccaat
ttcgccgccgccccgaccgcgtaccgcggcctgcgcaactccggccggctcgaggcgggc
gcgctgagcgtgccctacctgtccagcgcgggcgagccgttgaccccggacgtgaacgcc
tgggcccccgaggctctcggctcgcgggtgcacgaccactacgggcagaccgagatcggc
atgccgatcggattcccccaccacgaggccgtctcggtgccggtggtggacggcgcgatg
ggggtggcgctaccggggtggtcggtgaccgtcctggacccggaccacgacgagcccgct
gacctgggaacgatcggcaggctggccgtcgtggtggcgaacagtccgcacatgaccttc
gccgcctacgccgacggagacgaccacggtcgcctcgtcggcgacggccgctactacgtc
accggagacaccgcgaccatcgacgccgccggggtggtgcggttctcggcccgcgacgac
gacgtgatcatcatggccggctaccgcatcggcccgttcgacgtggagtcggtgctcgcg
caacaccccgcggtggccgagtgcgccgtgatcgccgcgccggacgaggcccggggcgag
gtcgtcgaggcgtacgtggtgaccaccgccgccagcgccgtcacggaggaagagctgcgg
cagtgggtgaaggagcgctacgccgcgcacgcctacccgcggcgtgtccacttcgtcccc
agtctgccgaagacccccagcggcaagatccagcgcaacgagcttcgcagaagacgccgc
gcggagattctcggcgggcgcggtttccgatga

DBGET integrated database retrieval system