KEGG   Frankia sp. EAN1pec: Franean1_3257Help
Entry
Franean1_3257     CDS       T00608                                 

Definition
glycoside hydrolase family protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
fre  Frankia sp. EAN1pec
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Franean1_3257
  Lipid metabolism
   00600 Sphingolipid metabolism
    Franean1_3257
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Franean1_3257
Enzymes [BR:fre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Franean1_3257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(3854969..3858022)
Genome map
AA seq 1017 aa AA seqDB search
MTGTDFTAVPWEDSGFQALGRLPMHSIRRPAEVELDGVWDFQLLDSPTAPPGAEWKRADV
PGLWTMSEAGDPAHYTNVRMPFDETPPRIPARNPTGVYRRSFELRPAAGRRAILHVGAAE
GLLRVFVNGRAIGVSTDSHLAAEFDITEACVAGGRDRHTVELVISKWSSVSYLEDQDHWW
QSGITRSVYVYTLPEIRLADLAVVADFDPEARRGTLRLEVSTAGLDHLPELAWTVRVDVL
GRRSTLPVTPCSPAPGLPPPWDDRSVRPEPRVPADFMSLVSQIAADAPIPPRWSAAVPSL
RRSLAPRRPAGTATLHLDGLEVEPWSAESPHLEDLVVALVSPGGEVVDETRTRIGFRRVR
IEGRDLLVNGGRILIQGVNRHDTDARTGRVLSARTMLAELSLLKRFNVNAIRTSHYPNDP
RLLELCDELGFYVVDEADIEAHAFANAICDDPRYLPAFLDRVSRMTLRDRNHPSVIVWSL
GNETGYGANHDAAAGWLRRFDPTRPLHYEGAIALDWHGGRAATDIVCPMYPSFEALAAFS
ADPRADRPVILCEYAYSQGNSTGGLAEYWEMFETLPGLQGGFIWEFKDHSLDPAGDGGYR
YGGDFGDVPHDGATLVNGIVFPDLTPQPALYEARGLFSPVRIVSDAAAALAGAIGIRNRQ
SFNDLSAYVLELQVENDRSTDPVTVDVPDVAPGATGTIELPDPIRKLLGSAPPLALTLTV
RTRQGARWAPAGTVVAAHQITFPRPPVALLSAPVPDALRVDQDGSVVHPLLRRAPALCLW
RAVTDNDKSFSLDQRFVRSGFFRLTPGAVTAEADGGSLTITTAYATAFGTEVTHRRVISA
LAEHDYRFDEHVQLPADTEDALRVGVEFELTPGFDDARWVGLGPWENYPDRRSSALLGSW
RERIDDLAVPYLVPQENGGRGAVSELCLSGPAGTVRTFHPTPVQMAVGRHRVDQLEAAAH
WWELPPSDVTVVHLDVAHRGVGTAQLGPDTRPRHRLTDHEYTWTWRLRLESAAGAAV
NT seq 3054 nt NT seq  +upstreamnt  +downstreamnt
atgactgggaccgacttcaccgcagtgccgtgggaggacagcggcttccaggccctgggt
cggctgccgatgcattcgatcaggcgacccgccgaggtcgagctggacggggtgtgggac
ttccagttgctggacagcccgaccgcgccccccggtgcggagtggaagcgcgccgacgtc
cccggcctctggacgatgagcgaggccggcgacccggcgcactacacgaatgtccggatg
ccgttcgacgagacgcccccgcgcatcccggcgcgcaaccccaccggggtctaccggcgt
tccttcgagctgcgccccgccgcgggccgccgggcgatcctgcatgtcggggcggcggag
ggcctgctgcgggtgttcgtgaacgggcgcgcgatcggcgtctccactgactcgcatctc
gccgccgagttcgacatcaccgaggcctgtgtcgccggcggacgggaccggcacacggtg
gagctggtgatctccaagtggtcgtcggtctcctatctcgaggaccaggatcactggtgg
cagtcgggtatcacccggtcggtgtacgtctacacgctcccggagatccggctggccgac
ctggctgtcgtcgccgacttcgatcccgaggcgcgtcgcgggacgctgcgcctggaggtg
tcgaccgccggtctcgaccacctgccggaactcgcgtggaccgtgcgggtcgacgtcctg
gggcgccgatcgacgctgccggtcaccccctgctccccggctccgggactcccaccgccc
tgggacgaccggtcggtccggcccgagccccgcgtcccggccgacttcatgagcctggtc
tcccagatagccgcggacgccccgatcccgccgaggtggtcggcggcggttccgtccctg
agacgcagcctcgcgccccggcggcctgccggcaccgccacgctccacctcgacggcctc
gaggtggagccgtggtcggccgagtctccccatctggaggatctcgtcgtcgcgctcgtc
tcccccggcggcgaggtcgtggacgagacccgcaccaggatcggcttccggcgggtccgg
atcgagggccgggatctgctggtcaacggcggacggatcctcatccagggggtgaaccgc
cacgacacggacgcccgcaccggccgggttctctcggcgcggacgatgctcgcggagctc
tccctgctcaaacggttcaacgtgaacgcgatccgcacctcgcactatcccaacgacccg
cgcctgctggagctgtgtgacgagctcggcttctacgtcgtcgacgaggcggacatcgag
gcgcacgccttcgccaacgcgatctgcgacgatccgcgctacctgccggctttcctcgac
cgggtgtcgcggatgacgctgcgcgaccgcaaccatccgagcgtgatcgtctggtcgctc
ggcaacgagacgggctacggagcgaaccacgacgccgccgccggatggctgcgccgcttc
gacccgacccgccccctgcactacgagggggcgatcgccctcgactggcacggcggccgg
gccgcgaccgacatcgtctgcccgatgtacccctcgttcgaggcgctggccgccttctcc
gccgatccgcgggccgaccgtccggtgatcctgtgcgagtacgcctactcgcaggggaac
tcgaccggagggctggccgagtactgggagatgttcgagacgctgcccggcctgcagggc
gggttcatctgggagttcaaggaccattccctcgatcccgcgggcgacggcgggtaccgc
tacggcggcgacttcggggacgtcccccacgacggcgcgaccctggtgaacggcatcgtc
tttcccgacctcaccccccagcccgcgctgtacgaggcacgcggcctgttcagcccggta
cggatcgtctcggacgccgcggccgcgctcgcgggggcgatcggcatccgcaaccgccag
tccttcaacgacctgagcgcctacgtcctggaactacaggtggagaacgaccggtcgacg
gacccggtcaccgtcgacgtgccggacgtcgcgcccggggcgaccgggaccatcgagctg
cccgacccgatccgcaagctgctcgggtccgcaccgccgttggccctgaccctgaccgtg
cggaccaggcagggcgcgcggtgggcaccggcgggcaccgtcgtcgccgcacaccagatc
accttcccgcggccgccggtcgccctgctgtccgccccggttcccgacgccctccgcgtc
gaccaggacgggtccgtcgtacaccccctgctgcggcgcgccccggcactgtgcctgtgg
cgggcagtcaccgacaacgacaagtccttctccctcgaccagcgcttcgtccgctccggc
ttcttccgcctcacccccggggcagtcacggccgaagcggacgggggcagcctgacgatc
accaccgcctacgccaccgcgttcggcaccgaggtgacgcaccgccgcgtcatcagcgcg
ctggccgagcacgactaccggttcgacgagcacgtccagctgcccgcggacaccgaggac
gcgctgcgggtcggcgtggagttcgagctcacgcccggtttcgacgacgcccgctgggtc
gggctcgggccgtgggagaactaccccgaccgccgctcctccgcgctcctcggctcctgg
cgggaacgcatcgacgacctggccgtgccctacctcgttccgcaggagaacggcgggcgc
ggggcggtgagcgagctgtgcctgagcggtccggccggcaccgtgcgcaccttccacccg
acgccggtgcagatggccgtcggccggcatcgcgtcgatcagctcgaggccgcggcccac
tggtgggagctcccgcccagcgacgtcaccgtcgtccacctcgacgtggcgcaccggggt
gtcggcaccgcccagctgggcccggacacccgtccccgtcaccgcctcaccgaccacgag
tacacatggacgtggcggctacggctcgagtcggccgccggggccgcggtctga

DBGET integrated database retrieval system