KEGG   Frankia sp. EAN1pec: Franean1_3662Help
Entry
Franean1_3662     CDS       T00608                                 

Definition
DNA-(apurinic or apyrimidinic site) lyase (EC:4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
fre  Frankia sp. EAN1pec
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:fre03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
4338709..4339527
Genome map
AA seq 272 aa AA seqDB search
MPEGHTVHRLAAVHQRMFRGRPVTVSSPQGRFVDGARMLDGQVLAEAEAHGKHLLLEFGD
EQILHIHLGIYGTYALGPGPAPVPTGAVRLRLTADTGYADLRGPNACELLAPGEVKVLRD
RLGPDPLRADADPALAWRRIERSRTPIAVLLLDQKVVAGPGNIYRAEVLFRAGIHPLLPG
RELARDQWAAIWADLVTLMADGVRTGRIDTVRPAHTPEAMGRPPRVDDHGGEVYVYRRTG
QPCLICAAEVRTVQLAGRNLFWCPACQPPVPG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaaggtcacactgtgcacaggttggccgccgtccaccagcggatgttccgtggc
cggccggtgaccgtgtcgagcccgcaaggccggttcgtcgacggcgcgcgcatgctggac
gggcaggtgctggccgaggctgaggcgcacggcaagcacctgctgctggagttcggcgac
gaacagatcctccacatccacctgggtatctatggcacctacgcactcggtcccggcccg
gcgcccgtgccgacgggagccgtccggctgcggctcacggccgacaccgggtacgccgac
ctgcgcggtcccaatgcctgcgagctgctggcacccggcgaggtgaaggtgctgcgtgac
cggctgggccccgatccgctgcgtgccgacgccgatccggcgctggcctggcgccggatc
gagcgcagccgcaccccgatcgccgtgctcctgctggaccagaaggtcgtcgccgggccg
gggaacatctaccgggccgaggtgctgttccgcgccgggatccacccgctgctgccgggc
cgggagctggcccgcgaccagtgggcggcgatctgggccgacctggtcacgctgatggca
gacggggtgcggacgggccggatcgacaccgtgcgccccgcgcacaccccggaggcgatg
ggccgcccgccgcgcgtcgacgatcacgggggagaggtctacgtgtaccgcaggacgggc
cagccctgcctgatctgcgccgccgaggtgcgcacggtgcagctggccggccgcaacctg
ttctggtgccccgcctgccagccacccgttccgggctga

DBGET integrated database retrieval system