KEGG   Frankia sp. EAN1pec: Franean1_4158Help
Entry
Franean1_4158     CDS       T00608                                 

Definition
magnesium chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
fre  Frankia sp. EAN1pec
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Franean1_4158
Enzymes [BR:fre01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Franean1_4158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
4938710..4941040
Genome map
AA seq 776 aa AA seqDB search
MVTFPFSALVGQDDLRLALLLNAVSPTVGGVLVRGEKGTAKSTAVRALAGLLPPVAVVPG
CRFSCDPAAPVVHCPDGPHPTSLADGHGAGGVGVSRPARLVELPVGASEDRVTGALDLDR
ALAEGVTALRPGLLAAAHRGVLYVDEVNLLADHLVDLLLDAAALGVAQVERDGVSVSHPA
RFWLVGTMNPEEGELRPQLLDRFGLTVQVAASRDPRIRAQVVRRRLTFEADPVGFAALWA
GAEAELAGRIAAAQARLGRVELSDAALDAVAAVCAACDVDGMRADVVLAKTAMARAAWEG
RAEVSPDDIRVSARFVLPHRRRRGPFDAPGGDGRALDDTVEEVLADRVRPGDGPDGDGDG
DGDGSDDSPGGGSPGGGQRWRDDTGGAGGWDGSGGDGSGVDVPAGGTGDLTPASARAGGE
SADLSGPAAGGPEGVGPAGPPPPGAALSSAAPAGGGGPAAEAGGPAGMARAAQTAQTHVD
GGAARGGGPAPAAGVPGMPFRPRLLSVAGLGAGAAGRRSAARTSRGAVARTGADAPGLHL
PATLLAAAPHQHGRGRTGPALVLDPADRRGAQRRGREGNLVLFVVDASGSMAARTRLRRV
STAVLSLLVDAYQRRDRIGMITFRGVGAQVVLAPTSSVEVGAARLVGLRTGGRTPIAAGL
ECAGVVLRAEARRDPDRRPLLVLVTDGRATAGGDPGAAARGLLRAAGGVAGQGGGARGGA
GAAGRVRRGGLASVVVDCETGPVRLGLAGRLAAVLGADLVGLDALPQAGGVPGRVA
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
gtggtgacgttcccgttctccgcgctggtcggccaggatgatctgcgcttggcgttgttg
ctcaatgcggtgtccccgacggtgggcggagtgctggtccgcggggagaagggcacggcg
aagtcgacggcggtccgcgcgctggcggggttgctgccgccggtggcggtggtgccgggc
tgccggttctcctgcgatccggcggcgccggtggtgcactgcccggatggcccgcacccg
accagcctcgccgacggtcacggtgccggcggggtgggggtgtcgcggccggcgcggctg
gtggagctgccggtcggcgcgtcggaggaccgggtgaccggcgcgttggacctggaccgg
gcactggccgaaggggtgaccgcgctgcgcccggggctgctcgcggccgcgcaccgcggg
gtgctctacgtcgacgaggtgaacctgctcgccgaccatctggtggatctgctgttggac
gcggccgcgctcggggtggcgcaggtggaacgcgacggggtgtcggtcagccatccggcg
cggttctggctggtggggacgatgaacccggaggagggtgagctgcgcccgcagctgctg
gaccggttcgggttgacggtgcaggtggcggccagccgtgacccgcggatacgcgcgcag
gtggtacgccgccggttgacgttcgaagccgacccggtcgggttcgccgcgctctgggcc
ggcgcggaggcggagctggcggggcggatcgcggccgcgcaggcccggttgggccgggtg
gagctctccgacgccgcgttggacgcggtcgccgcggtgtgcgcggcgtgtgacgtcgac
gggatgcgcgccgacgtggtgctggcgaagacggcgatggcgcgcgcggcgtgggagggt
cgggcggaggtcagcccggatgacattcgggtctcggcccggttcgtgctgccgcatcgg
cgccgccgtggcccgttcgacgccccgggtggggacggccgcgcgctcgacgacacggtc
gaggaggtgctggccgaccgggtacgccccggcgacggcccggacggggacggggacggg
gacggggacgggtcggatgattctcctggtggcgggtcgccgggtggtggccagcggtgg
cgtgacgacaccggcggcgccggcgggtgggacgggtctggcggggatgggtcgggggtg
gatgttccggctggtggtaccggtgacctcacccccgcttcggcgagggccggtggcgag
tccgctgatctgagcgggccggcggcgggtgggcctgagggtgtcgggccggcgggtcct
cccccgcccggtgccgccctgtcgtccgcggcgccggcgggcggcggtgggccggcagcg
gaggcgggcggcccggcgggcatggcccgagcagcccagacagcgcagacgcatgtggac
ggcggcgcggcgcgcggcggtgggccggcgccggcggctggggttcccggtatgccgttc
cggccgcggctgctgtccgtcgccgggctgggcgcgggggcggccgggcgtcgttcggcg
gcacgcacctcccgtggggcggtcgcccggaccggcgcggacgcacctgggttgcacctg
ccggcgacgctgctggccgctgccccccaccagcacggccggggccgcaccggcccggcg
ctggtgctcgaccccgccgaccggcgcggcgcgcagcggcgcggccgggaggggaacctg
gtgctgttcgtcgtcgacgccagcgggtcgatggccgcccgcacccggctgcgccgggtc
agcaccgcggtgctgtctctgcttgtcgacgcctaccagcgccgcgaccgcatcggcatg
atcacgttccggggggtgggtgcgcaggtggtgcttgcgccgacgtccagtgtggaggtg
ggggcggcgcggctggtcgggttgcggaccggggggcggaccccgatcgcggccgggttg
gaatgcgccggggtggtgctgcgcgccgaggcgcgccgcgaccctgaccgccgtcccctg
ctggtgctggtcaccgacgggcgggccaccgccgggggtgatccgggtgcggcggcgcgg
gggttgctgcgcgcggctggtggggtcgccgggcagggcggcggcgcacgcggtggggcc
ggggcggctggccgggtgcgccggggtgggttggcgagtgtggtcgtggactgtgagacc
ggcccggtgcgcctcgggctggccgggcggctcgccgccgtgctcggcgccgacctggtc
ggcctcgacgccctcccgcaggccggcggcgtccccgggcgggtcgcctga

DBGET integrated database retrieval system