KEGG   Frankia sp. EAN1pec: Franean1_4186Help
Entry
Franean1_4186     CDS       T00608                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
fre  Frankia sp. EAN1pec
Pathway
fre00071  Fatty acid degradation
fre00280  Valine, leucine and isoleucine degradation
fre00281  Geraniol degradation
fre00310  Lysine degradation
fre00360  Phenylalanine metabolism
fre00362  Benzoate degradation
fre00380  Tryptophan metabolism
fre00410  beta-Alanine metabolism
fre00627  Aminobenzoate degradation
fre00640  Propanoate metabolism
fre00650  Butanoate metabolism
fre00903  Limonene and pinene degradation
fre00930  Caprolactam degradation
fre01100  Metabolic pathways
fre01110  Biosynthesis of secondary metabolites
fre01120  Microbial metabolism in diverse environments
fre01130  Biosynthesis of antibiotics
fre01212  Fatty acid metabolism
Module
fre_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Franean1_4186
   00650 Butanoate metabolism
    Franean1_4186
  Lipid metabolism
   00071 Fatty acid degradation
    Franean1_4186
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Franean1_4186
   00310 Lysine degradation
    Franean1_4186
   00360 Phenylalanine metabolism
    Franean1_4186
   00380 Tryptophan metabolism
    Franean1_4186
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Franean1_4186
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Franean1_4186
   00281 Geraniol degradation
    Franean1_4186
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Franean1_4186
   00627 Aminobenzoate degradation
    Franean1_4186
   00930 Caprolactam degradation
    Franean1_4186
Enzymes [BR:fre01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Franean1_4186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: ABW13570
RhizoBase: Franean1_4186
UniProt: A8L896
Position
4978894..4980147
Genome map
AA seq 417 aa AA seqDB search
MPPEPTDPAVLDGPTVPAARTAAAALAEPAVPTEPAVLVRREGALGRITLNRPKAINALT
TGMVQAIDAALRTWAADDGIAAVLVDGAGGRGLCAGGDIRFFHDCARRGDPAPKAFWAAE
YRLNALISTYPKPYVALMDGLVMGGGIGISAHGATRIVTERSVLSMPEVGIGFVPDVGGT
HLLARIPGEIGTHLALTGARIGAADAIACGLADHHLPSDALPAFVAALREAAEAAEAGLG
TAAAGLGAGGAGSLARRYATVAAATGPSSLAADRTWIDPCYRHGSVEEILAALTASPAPA
ARAAAEEIAAKSPTSLKVTLRALRSARALPGLGACLDQEYRIACVLLSAHDLVEGIRAAI
VDKDRSPRWSPDRLDDVTAEDVDRFFAPLGDAELGLGEADDSGPGSELSLRGREAAR
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccgaacccaccgaccccgccgtgctcgacgggcccaccgtgccggccgcgcgt
accgcggccgcagcgctcgccgagccggcggtgccgaccgagccggcggtgctcgtgcgc
cgcgagggtgccctcggccggatcacgctgaaccggccgaaggcgatcaacgcgctgacc
acgggcatggtgcaggccatcgacgcggcgctgcggacctgggcggccgacgacgggatc
gccgcggtgctcgtcgacggggcgggcgggcgcggcctgtgcgcgggcggcgacatccgt
ttcttccatgactgcgcgcggcgcggcgacccggcaccgaaggcgttctgggccgccgag
taccggctcaacgcgctgatcagcacctacccgaagccgtatgtggcgctgatggacggg
ctcgtcatgggcggcgggatcgggatctcggcgcacggcgccacccggatcgtcaccgag
cgctcggtgctgtcgatgcccgaggtcgggatcggcttcgtccccgacgtcggtggcacc
cacctgctcgcgcggatacccggggagatcgggacgcatctggccctcaccggcgcccgg
atcggcgccgccgacgccatcgcctgcgggctggccgaccaccacctgcccagcgacgcg
ctgccggcgttcgtcgccgcgctgcgcgaggccgccgaggccgccgaggccggcctcggc
accgcagcggccggcctcggcgcgggcggcgcgggctcactggcccgccggtacgcgacg
gtcgccgccgcgaccggcccgtcctcgctggcggccgaccggacctggatcgacccgtgc
taccggcacggcagcgtcgaagagattcttgccgcgctgacggccagccccgccccggcg
gcccgcgccgccgcggaggagatcgccgcgaagtcaccgacctcgctgaaggtgaccctg
cgcgcgctgcgttcggcacgggcgctgcccgggctgggagcctgcctggaccaggagtac
cggatcgcctgcgtgctgctgagcgcccacgacctcgtggagggcatccgcgcggccatc
gtcgacaaggaccgctccccccgctggtccccggaccggctcgacgacgtcacggccgag
gacgtcgaccggttcttcgccccgctgggcgacgccgagctcggcctgggcgaagccgac
gactccggtccgggcagcgagctcagtctgcgcggaagagaggcagcccgatga

DBGET integrated database retrieval system