KEGG   Frankia sp. EAN1pec: Franean1_4520Help
Entry
Franean1_4520     CDS       T00608                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
fre  Frankia sp. EAN1pec
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Franean1_4520
   01230 Biosynthesis of amino acids
    Franean1_4520
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Franean1_4520
  Energy metabolism
   00680 Methane metabolism
    Franean1_4520
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Franean1_4520
Enzymes [BR:fre01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Franean1_4520
Exosome [BR:fre04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Franean1_4520
  Exosomal proteins of melanoma cells
   Franean1_4520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
5392765..5393499
Genome map
AA seq 244 aa AA seqDB search
MTGSRTLLLLRHGESAWNAADRFAGWVDVPLSARGRVQAGRCGDLLRDTGLLPDVVHTSL
LRRAVSTADLALDAADRHWIPVRRSWRLNERHYGALQGRNRMQVRAEYGADLLRFWRRSF
HGTPPPIDPGSVFGQDDDARYRELGVHVPRTESIADVLDRLRPYYESEIANDLDAGRTVL
VVAHGNVLRALIRHLGAQAGDPADDDLSEVRLPTGALLRYDLTDVGLPVRPGGVLLSASG
ATQK
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaccgggtcccgcaccctgctgctgctgcggcacggggagagcgcctggaacgccgca
gaccgcttcgccggctgggtcgacgtgccgctgtccgcacgcggccgggttcaggccggc
cggtgcggcgatctgctccgcgacaccggcctcctccccgacgtcgtgcacacctccctt
ctgcgccgggccgtgtcgaccgcggacctcgcactcgacgccgccgaccggcactggatc
ccggtccggcgcagctggcggctcaacgagcgccactacggcgcactgcagggccgtaac
cgcatgcaggtccgcgccgagtacggcgcggacctgcttcgtttctggcgccgctcgttc
cacggaacgccgccgccgatcgacccgggcagcgtcttcgggcaggacgacgacgcacgg
tatcgggagctgggcgtgcacgtcccccggacggagtccatcgcggacgtcctcgaccgg
ctccgcccgtactacgagtcggagatcgcgaacgatctggatgccggccggaccgttctg
gtcgtggcccacggcaacgtcctgcgtgccctgatccgccacctcggcgcccaggccggc
gacccggccgacgacgacctgagcgaggtgcggctgcccacgggcgccctgctgcgctac
gacctcaccgacgtcgggctgccggtccggcccggcggtgtcctgctgagcgcgtcggga
gcgacgcagaaatga

DBGET integrated database retrieval system