KEGG   Frankia sp. EAN1pec: Franean1_4520Help
Entry
Franean1_4520     CDS       T00608                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
fre  Frankia sp. EAN1pec
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Franean1_4520
   01230 Biosynthesis of amino acids
    Franean1_4520
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Franean1_4520
  Energy metabolism
   00680 Methane metabolism
    Franean1_4520
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Franean1_4520
Enzymes [BR:fre01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Franean1_4520
Exosome [BR:fre04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Franean1_4520
  Exosomal proteins of melanoma cells
   Franean1_4520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
5392765..5393499
Genome map
AA seq 244 aa AA seqDB search
MTGSRTLLLLRHGESAWNAADRFAGWVDVPLSARGRVQAGRCGDLLRDTGLLPDVVHTSL
LRRAVSTADLALDAADRHWIPVRRSWRLNERHYGALQGRNRMQVRAEYGADLLRFWRRSF
HGTPPPIDPGSVFGQDDDARYRELGVHVPRTESIADVLDRLRPYYESEIANDLDAGRTVL
VVAHGNVLRALIRHLGAQAGDPADDDLSEVRLPTGALLRYDLTDVGLPVRPGGVLLSASG
ATQK
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaccgggtcccgcaccctgctgctgctgcggcacggggagagcgcctggaacgccgca
gaccgcttcgccggctgggtcgacgtgccgctgtccgcacgcggccgggttcaggccggc
cggtgcggcgatctgctccgcgacaccggcctcctccccgacgtcgtgcacacctccctt
ctgcgccgggccgtgtcgaccgcggacctcgcactcgacgccgccgaccggcactggatc
ccggtccggcgcagctggcggctcaacgagcgccactacggcgcactgcagggccgtaac
cgcatgcaggtccgcgccgagtacggcgcggacctgcttcgtttctggcgccgctcgttc
cacggaacgccgccgccgatcgacccgggcagcgtcttcgggcaggacgacgacgcacgg
tatcgggagctgggcgtgcacgtcccccggacggagtccatcgcggacgtcctcgaccgg
ctccgcccgtactacgagtcggagatcgcgaacgatctggatgccggccggaccgttctg
gtcgtggcccacggcaacgtcctgcgtgccctgatccgccacctcggcgcccaggccggc
gacccggccgacgacgacctgagcgaggtgcggctgcccacgggcgccctgctgcgctac
gacctcaccgacgtcgggctgccggtccggcccggcggtgtcctgctgagcgcgtcggga
gcgacgcagaaatga

DBGET integrated database retrieval system