KEGG   Frankia sp. EAN1pec: Franean1_4665Help
Entry
Franean1_4665     CDS       T00608                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
fre  Frankia sp. EAN1pec
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Franean1_4665
   00051 Fructose and mannose metabolism
    Franean1_4665
Enzymes [BR:fre01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Franean1_4665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
5568222..5569439
Genome map
AA seq 405 aa AA seqDB search
MPRQPTPEDKFSFGLWTVGWTGTDPFGLPTRTALDPWEYADRLAEIGAWGITLHDNDVFP
FDADDAAAARASRRLKEATDASGLVIEMVTTNTFTHPVFKDGGLTSNDRGVRRFGLRKVL
RAVDLAAQLGATTFVMWGGREGSEYDGSKDVFAALERYREGLDTVAGYIKSQGYDLRIAL
EPKPNEPRGDILLPTVGHALALIAELENGDIVGVNPETGHEQMANLNYTHALGQALWSGK
LFHIDLNGQRGLKYDQDLVFGHGDLVSAFFTVDLLENGFPGYPDGPRYTGPRHFDYKPSR
TEGMAGVWESARACMSTYLLLAEKVAAFRADPLVQEAMAYAGVFELAKPTLAPGETAADL
LASDDGFDPAKAAERDFGFVRLQQLAIEHLVGSPAPGSAAARSAG
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgccacgacagcccactcccgaggacaagttctccttcggcctgtggacggtcggctgg
accggcaccgacccgttcggcctgccgacccggacggccctcgacccgtgggagtacgcc
gaccggctggccgagataggcgcctggggcatcaccctgcacgacaacgacgtcttcccc
ttcgacgccgatgacgccgccgccgcgcgggcgtcccgccggctcaaggaggccaccgac
gcctccggcctggtcatcgagatggtgaccacgaacaccttcacccatcccgtcttcaag
gacggcggcctgacctcgaacgaccgcggcgtgcgccggttcggcctgcgcaaggtgctg
cgcgcggtggatctcgcggcgcagctcggcgcgaccacgttcgtgatgtggggcggccgg
gagggcagcgagtacgacgggtcgaaggacgtcttcgccgcgctggagcgctaccgggag
ggcctggacaccgtcgccggctacatcaaaagccagggctacgacctgcggatcgcgctc
gaacccaagccgaacgagccgcgcggcgacatcctcctgcccaccgtcgggcatgcgctg
gcgctgatcgccgagctggagaacggcgacatcgtcggggtcaacccggagaccgggcac
gagcagatggccaacctcaactacacccacgcgctcggccaggcactgtggagcgggaag
ctgttccacatcgacctcaacgggcagcggggcctgaagtacgaccaggacctggtcttc
gggcacggcgatctcgtctcggcgttcttcaccgtcgacctgctcgagaacggcttcccg
ggctacccggacggcccccggtacaccggtccccgccacttcgactacaagccgtcgcgg
acggagggcatggccggggtctgggagtcggcgcgggcgtgcatgtcgacctacctgctg
ctcgccgagaaggtggcggcgttccgcgccgatcccctcgtccaggaggcgatggcctac
gccggcgtgttcgagctggccaagcccaccctcgcccccggcgagaccgcggccgatctc
ctggcctcggacgacggcttcgacccggccaaggcggccgagcgggacttcggtttcgtg
cggctccagcaactggcgatcgagcatctcgtcggctcgcccgccccgggctcggcagcc
gcccgttccgccggctga

DBGET integrated database retrieval system