KEGG   Frankia sp. EAN1pec: Franean1_4665Help
Entry
Franean1_4665     CDS       T00608                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
fre  Frankia sp. EAN1pec
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:fre00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:fre00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
5568222..5569439
Genome map
AA seq 405 aa AA seqDB search
MPRQPTPEDKFSFGLWTVGWTGTDPFGLPTRTALDPWEYADRLAEIGAWGITLHDNDVFP
FDADDAAAARASRRLKEATDASGLVIEMVTTNTFTHPVFKDGGLTSNDRGVRRFGLRKVL
RAVDLAAQLGATTFVMWGGREGSEYDGSKDVFAALERYREGLDTVAGYIKSQGYDLRIAL
EPKPNEPRGDILLPTVGHALALIAELENGDIVGVNPETGHEQMANLNYTHALGQALWSGK
LFHIDLNGQRGLKYDQDLVFGHGDLVSAFFTVDLLENGFPGYPDGPRYTGPRHFDYKPSR
TEGMAGVWESARACMSTYLLLAEKVAAFRADPLVQEAMAYAGVFELAKPTLAPGETAADL
LASDDGFDPAKAAERDFGFVRLQQLAIEHLVGSPAPGSAAARSAG
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgccacgacagcccactcccgaggacaagttctccttcggcctgtggacggtcggctgg
accggcaccgacccgttcggcctgccgacccggacggccctcgacccgtgggagtacgcc
gaccggctggccgagataggcgcctggggcatcaccctgcacgacaacgacgtcttcccc
ttcgacgccgatgacgccgccgccgcgcgggcgtcccgccggctcaaggaggccaccgac
gcctccggcctggtcatcgagatggtgaccacgaacaccttcacccatcccgtcttcaag
gacggcggcctgacctcgaacgaccgcggcgtgcgccggttcggcctgcgcaaggtgctg
cgcgcggtggatctcgcggcgcagctcggcgcgaccacgttcgtgatgtggggcggccgg
gagggcagcgagtacgacgggtcgaaggacgtcttcgccgcgctggagcgctaccgggag
ggcctggacaccgtcgccggctacatcaaaagccagggctacgacctgcggatcgcgctc
gaacccaagccgaacgagccgcgcggcgacatcctcctgcccaccgtcgggcatgcgctg
gcgctgatcgccgagctggagaacggcgacatcgtcggggtcaacccggagaccgggcac
gagcagatggccaacctcaactacacccacgcgctcggccaggcactgtggagcgggaag
ctgttccacatcgacctcaacgggcagcggggcctgaagtacgaccaggacctggtcttc
gggcacggcgatctcgtctcggcgttcttcaccgtcgacctgctcgagaacggcttcccg
ggctacccggacggcccccggtacaccggtccccgccacttcgactacaagccgtcgcgg
acggagggcatggccggggtctgggagtcggcgcgggcgtgcatgtcgacctacctgctg
ctcgccgagaaggtggcggcgttccgcgccgatcccctcgtccaggaggcgatggcctac
gccggcgtgttcgagctggccaagcccaccctcgcccccggcgagaccgcggccgatctc
ctggcctcggacgacggcttcgacccggccaaggcggccgagcgggacttcggtttcgtg
cggctccagcaactggcgatcgagcatctcgtcggctcgcccgccccgggctcggcagcc
gcccgttccgccggctga

DBGET integrated database retrieval system