KEGG   Frankia sp. EAN1pec: Franean1_4744Help
Entry
Franean1_4744     CDS       T00608                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
fre  Frankia sp. EAN1pec
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Franean1_4744
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Franean1_4744
   00650 Butanoate metabolism
    Franean1_4744
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Franean1_4744
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Franean1_4744
   00622 Xylene degradation
    Franean1_4744
   00621 Dioxin degradation
    Franean1_4744
Enzymes [BR:fre01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Franean1_4744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(5665819..5666745)
Genome map
AA seq 308 aa AA seqDB search
MQQVAIIGSGNIGTDLLIKIKRRSESLSVAAMVGIDPESDGLARARRLGVATTSDGVAGL
LAMPEFEQAGIVLDATSANAHRANAAALAPYGRRLIDLTPAALGPFVVPAVNLDEHLSAP
NVNMTTCGGQATVPIVAAISRVTPVAYAEIVATVASKSAGPGTRANIDEFTETTAHALES
VGGARRGKAIIILNPAEPPLIMRDTVLCLVGDVDRDAVTESIHRMIADVAAYVPGYRLKQ
DVQFTPVDPAEMRILLPDDTVDVRWKVSVFLEVEGAAHYLPAYAGNLDIMTSAAVRVAER
IAGAEVTA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcaggtggcgatcatcgggtcggggaacatcggcaccgacctcctgatcaagatc
aagcgaaggtccgagtcgctgagcgtggcggccatggtggggatcgacccggagtccgac
ggcctcgcccgcgccaggcggctgggcgtcgccacgacgtccgacggggtggccggtctc
ctggcgatgcccgagttcgaacaggccggcatcgtgctcgacgcgacgagcgccaacgcg
caccgggcgaacgccgcggcgctggccccgtacggccggcggctgatcgacctcaccccg
gcggcgctcgggccgttcgtggtgcccgcggtcaacctcgacgagcacctgagcgccccc
aacgtcaacatgacgacctgcggcgggcaggccaccgtcccgatcgtcgcggcgatctca
cgcgtcaccccggtggcctacgcggagatcgtcgccacggtggcgtcgaagtccgccggg
cccggcacccgcgccaacatcgacgagttcaccgagacgacggcgcacgcgctggagtcg
gtgggcggcgcgcggcgcggcaaggccatcatcatcctgaacccggccgagccgccgctc
atcatgcgggacaccgtgctctgcctggtcggcgacgtcgaccgggacgcggtcaccgaa
tcgatccaccggatgatcgcggacgtcgccgcctacgtgcccggctaccgcctgaagcag
gacgtgcagttcactcccgtggacccggccgagatgcgcattctcctgccggacgacacg
gtcgacgtccgctggaaggtgagcgtgttcctcgaggtggagggcgccgctcattatctg
ccggcctacgccggcaacctggacatcatgacgtcggcggccgtgcgggtcgccgagcgc
atcgctggagccgaggtgacggcatga

DBGET integrated database retrieval system