KEGG   Frankia sp. EAN1pec: Franean1_4787Help
Entry
Franean1_4787     CDS       T00608                                 

Definition
(GenBank) FMN-binding negative transcriptional regulator
  KO
K07734  
transcriptional regulator
Organism
fre  Frankia sp. EAN1pec
Brite
Transcription factors [BR:fre03000]
 Prokaryotic Type
  Other transcription factors
   Others
    Franean1_4787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
RhizoBase: 
UniProt: 
Position
5713106..5713762
Genome map
AA seq 218 aa AA seqDB search
MYVPRAFALTDLDQVAGCVAAAGAADLVTVSGTQPVATLVPIIWDRTPSGPDAPHGRLLG
HLAHANPQWRTASPGCAALAIVHGPQAYISPSWYAAKTEHGRVVPTWNYTAIHFSGPVTF
HHDPEQLRGIVTRLTDRHEQHREQPWAVDDAPPDFVAGLLRAIVGFELAVASVTAKEKLS
QNRSPADRAGAIAGLRGEPDAGSAAIADLMQPRPPGQT
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
gtgtatgtgccccgcgccttcgccctcaccgacctcgaccaggtcgctggctgcgttgcg
gccgcgggagcagccgacctcgtcaccgtcagcggcacccagccggtggccaccctcgtc
ccgatcatctgggatcgcaccccgagcggacctgatgcgccgcacggacggctgctgggg
catctcgcccacgcgaacccgcagtggcggaccgcgtccccgggctgcgcagcgctggcg
atcgtgcacgggccgcaggcgtacatctcaccgtcctggtacgccgccaagaccgaacac
ggacgggtcgtcccgacctggaactacaccgcgatccacttcagcggacccgtcacgttc
caccacgaccccgaacagctccgtggcatcgtcacccgactcaccgaccggcacgaacag
caccgggaacagccctgggctgtggacgacgccccgcccgacttcgtggccggtctgctg
cgggcgatcgtcggcttcgaactcgccgtcgcgtcggtgacggcgaaggagaaactcagc
cagaaccgctcccccgccgaccgcgccggggccatcgcggggctgcgcggggaacccgac
gcagggtctgccgccatcgccgacctcatgcaaccccggccacctgggcagacctga

DBGET integrated database retrieval system