KEGG   Frankia sp. EAN1pec: Franean1_4895Help
Entry
Franean1_4895     CDS       T00608                                 

Definition
exodeoxyribonuclease V (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
fre  Frankia sp. EAN1pec
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fre00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Franean1_4895
Enzymes [BR:fre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Franean1_4895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
5874032..5876362
Genome map
AA seq 776 aa AA seqDB search
MPEDAADSPFRTAAAVEDRAAGPPSAGPGPTPDDAVVFKAFCGAGLWPGLGRTTAGRLEE
AGIERREHVDLHRLSSVPGVSGPRARRLLDTFRAAEPTYAAVEMLVAARLPARLARGLAD
ALGPTVAKALRADPWSLLEGGEAELGDADRFARHLGLDRADPRRGPAVLIHLLGRAASRA
GDTAAPVAEVARAAVREGVTEPLDALSAALDSGRVIQVDDRLALERYAMAEQAISDGVER
LLATAEPFRPEAGGRRARRRAGSGLGEERPAVAAPPEPPAPTSMFDDDAPDVHTPDDEPP
DNGAAGSAYGAAGSDAADGGADTVPGGAEPGAAADRAVAGLDEVQLQAARTALEVGVSVL
TGGPGTGKSRTVAAVVRLAEAAGVEVALAAPTGRAAKRLEELCGAPASTLHRLLGAQGRG
GGFARDEHNPIEADLVVVDETSMLDAELAAALLDACADGTHLLLVGDPAQLPSIGPGQVL
ADLLEAEVAPVTELTRLYRQTDGGAIATMAAAVRRGELPPPGSGREVVVVAARSSGEAAH
RVVQLVTDSIPRALGIPTEDVQVVTPVHGGPAGTGALNAALKNALNPGRGEVSGFDVGDR
VVATANHLDLGFANGEIGVVVALGERGGLRVAFPGGELDVPSHGAVDLRHGWAVTVHRAQ
GSEWAAVVGVFPPEAGRMLTRPLIYTAMTRARSHLSVVSVNGPALRAAVRDAGGRRRATL
LPALLTGESAEPFGPMDDLDDTDGQPGEDGFGAGLADGAAAGAAVLAPATKEPVRP
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaagacgccgccgactccccgtttcggaccgctgccgcggtcgaggaccgcgcc
gccggcccgccgtcggccggcccgggaccaaccccggacgacgccgtagtcttcaaggcc
ttctgcggcgccggcctgtggccgggcctgggccggacgacggcgggccggttggaggag
gccggcatcgaacgccgcgaacacgtcgacctgcaccgcctttcctcggtgccgggtgtc
tccgggccgcgggctcgccgcctgctcgacacattccgcgcggcggaacccacctacgcc
gcggtggagatgctggtcgcggcgcgcctgccggcgcggcttgcccgcggcctggccgac
gcgctcggccccacggtggccaaggcgctgcgcgcggacccctggtcgctgctcgaggga
ggcgaggccgagctcggcgacgccgatcgcttcgcccgccacctcgggctggacagggcg
gacccccgccgcgggccggcggtcctcatccacctgctcggtcgcgcggccagccgcgcc
ggcgacaccgccgccccggtcgccgaggtggcccgggcggcggtccgcgagggggtcacc
gaacccctcgacgcgctgtccgccgcgctcgactccggccgggtgatccaggtcgacgac
cgtctcgccctcgagcggtacgcgatggccgagcaggcgatctcggacggggtggagcgc
ctgctcgcgaccgccgaaccgttccggcccgaggccggcgggcggcgggcccggcggcgc
gccggcagcggactgggcgaggagcggccggcagtcgccgcgccgcccgaaccgccggcg
ccgacgtcgatgttcgacgacgacgcaccggacgtccacacaccagacgacgagccaccc
gacaacggcgcggccggctccgcctacggcgcggctgggtccgatgcggctgacggcggc
gcggacacggtccccggcggcgccgaaccgggcgccgcggccgaccgcgccgtggccggg
ctggacgaggtccagctccaagccgcccgcaccgcgctcgaggtcggcgtgagcgtgctg
acgggtggtcccggcacgggcaagagccgcaccgtcgccgcggtcgtccggctcgccgag
gccgccggcgtcgaggtggcgctcgccgcgccaaccggccgggcggcgaaacggctcgag
gagctgtgtggcgcgccggccagcaccctgcaccggctgctcggcgcgcagggccgcggc
ggcgggttcgcccgcgacgagcacaaccccatcgaggccgacctggtcgtcgtcgacgag
acgtccatgctggacgccgaactcgccgccgccctgctggacgcctgcgccgacggcacc
cacctgctcctcgtcggcgaccctgcgcagctccccagcatcggaccgggtcaggtcctg
gccgacctgctggaggcggaggtcgcgccagtcaccgagctgacccggctctaccggcag
accgacggcggcgcgatcgccacgatggccgcggcggtccgccgcggtgagctgccgcca
cccggttcgggccgtgaggtcgtcgtcgtggcggcgcgctcctccggcgaggccgcgcac
cgcgtcgtccagctcgtcaccgactcgattccgcgggccctgggcatacccaccgaggac
gtgcaggtggtgacgcccgtgcacggcgggccggccggcaccggcgcgctcaacgcggcg
ttgaagaacgcgctcaacccgggccgcggcgaggtctccggcttcgacgtcggcgaccgg
gtggtggccaccgcgaaccaccttgacctggggttcgccaacggtgagatcggcgtggtc
gtcgcgctcggcgaacggggcggcctgcgggtcgccttccccggcggcgagctcgacgtc
ccctcgcacggcgccgtggacctgcgccacggatgggccgtcacggtgcaccgcgcccag
ggcagcgagtgggccgccgtggtcggcgtcttcccaccggaggccggccggatgcttacc
cggccgctgatctacacggcgatgacgcgggcacgcagccacctgtcagtcgtgtcggtg
aacggcccggcgctgcgggccgcggtccgcgacgcgggtggccggcggcgggcgaccctc
ctcccggcgctgctgaccggcgagtccgcggagccattcgggccgatggacgacctggac
gacaccgacggccagcccggcgaggacggcttcggcgccggcctcgctgacggcgccgcc
gccggggcggccgttctcgcgccggccacgaaggagccggtcagaccatga

DBGET integrated database retrieval system