KEGG   Frankia sp. EAN1pec: Franean1_4923Help
Entry
Franean1_4923     CDS       T00608                                 

Definition
recombinase D (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
fre  Frankia sp. EAN1pec
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:fre03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(5910751..5912985)
Genome map
AA seq 744 aa AA seqDB search
MSRPAAAPFQLAVLEAVLERITYANEETGYTVARVDTGRGGDLLTVVGALLGAQPGESLR
MRGRWGSHPQYGRQFQVEDYTTVLPATVQGIQRYLGSGLVKGIGPRFAERIVEHFGVDAL
DVIETEPARLIEVPGLGPKRTKAIAAAWEEQKAIKEVMVFLQGVGVSTSLAIKIYKQYGD
ASIGVVRTEPYRLAADVWGIGFRTADTIAQAVGIPHDSPQRIKAGLAFTLSEATDSGHCF
LPETRLIADAVRILGVDTGAVIEGLGELITEEGVVREDVPGEDPEQPVAAVYLVPFHRAE
ISVAGQLLRLLRADEDRLAAFAAVDWEKALGWLHTRTGTELAAAQREAVTLALTSRVAVL
TGGPGCGKSFTVRSVVELARARRAKVVLTAPTGRAAKRLAELTGHEASTVHRLLELRPGG
DAAYDRDRPLDADLVVVDEASMVDLLLMNKLVKAVPPGGHLLLVGDVDQLPSVGAGQVLR
DLLASGTPIPHVRLTQVFRQASESGVVTNAHRINRGDHPLVRGLDDFFLFVAEEAEDAAR
ITAEVVARRIPAKFGLDPRRDIQVLAPMHRGPAGAGALNIALQEALTPSLPDRPERRFGG
RVFRVGDKVTQVRNNYDKGANGVFNGTLGVVTALDNDNQTLTVRTDEDEDVDYEFTELDE
LTHAYAVTIHRSQGSEYPAVVIPLTTSAWMMLQRNLLYTAVTRAKKLVVLVGSRRAIGQA
VRSAGHGQRHTALAHRLQSAGRSG
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
gtgtcccgacccgccgccgcgccgttccagctcgccgtgctcgaggccgtcctcgaacgg
atcacctacgccaacgaggagaccgggtacaccgtcgcccgcgtcgacacgggccgcggc
ggcgacctgctgacggtcgtcggcgcgctgctcggagcccagcccggcgagtcgctgcgg
atgcgcgggcggtggggctcgcatccccagtacggccgccagttccaggtcgaggactac
accaccgtcctgccggccactgtccagggcatccagcggtacctcggatcaggcctggtc
aaggggatcgggccccggttcgccgagcgcatcgtcgagcacttcggcgtcgacgcgctg
gacgtcatcgagaccgagccggcgcggctcatcgaggttccgggtctcggccccaagcgg
acgaaggcgatcgccgcggcctgggaggaacagaaggccatcaaggaggtcatggtcttc
ctacagggcgtgggcgtctcgacctcgctggcgatcaagatctacaagcagtacggggac
gcctcgatcggagtggtgcgcaccgagccctaccggctggccgccgacgtgtggggcatc
gggttccgcaccgcggacaccatcgcgcaagcggtcggcatcccacacgacagcccgcag
cgcatcaaggccgggctcgcgttcaccctctccgaggccaccgacagcggccactgcttc
ctgcccgagacccggctgatcgccgacgccgtgcgcattctcggcgtcgacaccggcgcg
gtgatcgaggggctcggcgagctgatcaccgaggagggggtggtgcgcgaggacgtcccc
ggcgaggacccggagcagccggtcgccgcggtgtacctcgtcccgttccaccgcgccgag
atctccgtcgcggggcagctgctgcgcctgctgcgggccgacgaggaccgcctcgccgcg
ttcgccgccgtcgactgggagaaggcgctcggctggctgcacacccgtaccgggaccgag
ctggcggcggcgcagcgcgaggcggtcaccctcgctctcacctcccgggtggcggtgctg
accggcgggcccggctgcgggaagagcttcacggtgcgctcggtcgtcgagctggcccgc
gcccggcgggcgaaggtcgtcctcaccgccccgaccggacgggccgccaagcggctcgcc
gagctgaccggccacgaggcgtcgacggtgcaccggctgctcgagctgcgccccggcggc
gacgcggcctacgaccgggaccgcccgctcgacgccgacctcgtcgtggtggacgaggcg
tccatggtcgacctgctgctgatgaacaagctggtcaaggccgtcccgccgggcgggcac
ctgctgctggtgggcgacgtcgaccagcttccctccgtcggcgccgggcaggtgctgcgt
gatctgctcgcgtccggcacgccgatcccgcacgtgcggctgacccaggtgttccgccag
gccagcgagtcgggcgtggtgaccaacgcgcaccgcatcaaccgcggggaccatccgctg
gtgcgcggcctggacgacttcttcctcttcgtcgccgaggaggccgaggacgccgcccgg
atcaccgcggaggtggtggcgcggcggatcccggccaagttcggcctcgacccgcggcgc
gacatccaggtgctcgcgccgatgcaccgcggcccggccggcgccggggcgctcaacatc
gcgctgcaggaagcactcacgccgagcctgccggaccgccccgagcgccgcttcggcggc
cgggtgttccgggtcggcgacaaggtcacccaggtgcgcaacaactacgacaagggcgcg
aacggggtgttcaacgggacgctcggggtagtcaccgcgctcgacaacgacaaccagacc
ctgaccgtccgcaccgacgaggacgaggacgtcgactacgagttcaccgagctcgacgag
ctgacccacgcctacgcggtgactatccaccgttcgcagggcagcgagtacccggccgtg
gtcatcccgctgacgaccagcgcatggatgatgctgcagcgcaacctgctgtacacggcg
gtgacgcgggcgaagaagctggtggtcctggtcggctcgcgccgggccatcgggcaggcg
gtccgctcggccggccacgggcagcgccacaccgcgctcgcgcaccgcctgcagtccgcc
gggcgctccggatag

DBGET integrated database retrieval system