KEGG   Frankia sp. EAN1pec: Franean1_5145Help
Entry
Franean1_5145     CDS       T00608                                 

Definition
DNA recombination protein RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
fre  Frankia sp. EAN1pec
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fre00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Franean1_5145
Enzymes [BR:fre01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Franean1_5145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(6167330..6168049)
Genome map
AA seq 239 aa AA seqDB search
MIASVSGTVEVLSPGSAVVDVGGVGVLVWCTPSTLARLRVGERARLATTLVVRETELTLY
GFRDADERDVFEILQGAAGVGPRLAQAVLGVHSPDVIRRAVAEEDLATLTKVPGIGRKSA
QRIVLDLRDRLGPPSSPVPPQRAAAPPPAAADPRLGAAGEQVRDALVGLGYSAKEALDAV
VAARTALHGPGDGAAVTGGAAGGDGDGAAGDGAAGGADPAGPVDPAALLRASLAVLRPR
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgtcggtcagcggcacggtggaggtgctctcgcccggctcggcggtcgtcgac
gtcggtggcgtcggcgtcctggtgtggtgtacgccgtcgacgctggcccggctgcgggtc
ggcgagcgcgcgcggttggcgacgaccctcgtcgtccgggagaccgagctgacgctgtac
gggttccgcgacgccgacgagcgagacgtcttcgagatcctgcagggcgcggccggggtg
gggcccaggctcgcccaggccgtcctcggcgtgcacagtccggacgtcatccgccgggct
gtcgcggaggaggacctggccacgctcaccaaggtgccgggcatcggccgcaagagcgcc
cagcgcatcgtgctcgacctgcgggacaggctcggcccgccgtcctccccggtcccgccg
cagcgcgccgcggcgccgccgccggccgccgcggatccgcgtctcggcgccgcgggcgag
caggtccgggacgcgctggtcggcctcggttactccgcgaaggaggcgctggacgcggtg
gtcgcggctcggacggcgctgcacggccccggcgacggcgcggccgtgaccggcggcgcg
gcgggtggcgacggtgacggcgcggcgggtgacggcgcggcgggcggcgcggaccccgcc
ggtccggtcgaccccgcggcgctgctgcgggcgagcctcgccgtgctgcggccgcgatga

DBGET integrated database retrieval system