KEGG   Frankia sp. EAN1pec: Franean1_5162Help
Entry
Franean1_5162     CDS       T00608                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
fre  Frankia sp. EAN1pec
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Franean1_5162
Enzymes [BR:fre01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Franean1_5162
    3.5.1.-  
     Franean1_5162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
6186964..6187575
Genome map
AA seq 203 aa AA seqDB search
MATRYGPGVALVVLDLQNDFAAPGGSLYVDGGEDIVAGVNREIAAATSAGSPVFYTQDWH
PPSTPHFVTEGGIWPPHCVRDTPGARLCPDLTVAGEVIRKGVDGHDGYSGFSVRDPRSGE
QSATVLGERLAAGSVRTVVVVGLAGDYCVLETALDARALGLEVTLPLELTRFVELAEGDR
ERAIARMVGAGVRVEGLAARGRG
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgcggtacgggcccggcgtggcgctggtcgtcctcgacctgcagaacgacttc
gccgcgcccgggggcagcctctacgtcgacggcggcgaggacatcgtcgccggggtgaac
cgggagatcgcggcggcgacgagcgcgggctcccctgtcttctacacccaggactggcat
ccgccgtccacgccgcatttcgtcaccgagggcgggatctggccgccgcactgcgtgcga
gacacgcccggggcgcgcctgtgccccgacctgacggtggccggtgaggtgatccgcaag
ggcgtggacggccacgacgggtactcgggcttctccgtccgtgacccacgttcgggcgag
cagtcggcgaccgtgctcggcgagcggcttgccgcaggctccgtccgcacggtcgtggtg
gtgggcctggctggtgactactgcgtgctggagacggcgctcgacgcccgtgcgctgggt
ctggaggtgacgctcccgctggagctgacccggttcgtcgagctggcggagggtgatcgc
gaacgcgcgatcgcccggatggtcggggcgggcgtgcgggtggagggcctggccgccagg
ggacggggctga

DBGET integrated database retrieval system