KEGG   Frankia sp. EAN1pec: Franean1_5276Help
Entry
Franean1_5276     CDS       T00608                                 

Definition
glycoside hydrolase family 3 protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
fre  Frankia sp. EAN1pec
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Franean1_5276
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Franean1_5276
Enzymes [BR:fre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Franean1_5276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(6347184..6349154)
Genome map
AA seq 656 aa AA seqDB search
MVMRRVRVVGVALAVVLATLAGVTAFAWAVRGTDAGGSMADRLSLADGDTAGGSAGAGDP
GGGAAGAESGRGTAEHPADGPETGADELSAADPGGAGSGPGAGSAEENSWVEPTLAGLSL
EQRVGQMMMGYVFGTAGADRSPAVVTANRRTSGVDTAAEAVARRGLGGVIYFDAGGTGPG
ALPDNIVNPNQVKTLSADLSAAASIPLLIAADQEQGTVLRVRDGVTLLPGQMAQGATGRP
TDARDAAQITGADLRALGINVDFAPDADVNSDPANPVIGERSFGDDPTAVGRFTAAAVEG
YRQVGVAAAAKHFPGHGATSVDSHADLPTITRDRAALTALDLPPFRAAIAAGVPMVMVGH
LNVPALDPAAPATLSKPVVDGLLRHELGFDGVIVTDALNMAAITEHNTPGGAAVRAVQAG
VDMLLMPPDLTQALDAVVSAVRSGAIVPERIDASVRRILRMKWRLAHTEPAAARTPEEAA
ATAAAIAERAITLLDQPTCDLLPLSRGTAGAGAGGTQPAVEVSGPSGAAKMLVDALGARG
IGARLAAQGSGRPPAPPAAGASGAGTAVVRVVLVGNSPPPVTDRRTVVVSTGTPYRPPVA
AGAWLASYSRDPASMKALAAVLAGAVPPSGRLPVVTRTATGTALPRGAGLPTPRAC
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggtcatgcggcgtgtgcgggtcgtcggggtggcgctcgcggtcgtcctggcgacgctg
gccggtgtcacggcgttcgcctgggcggtccgcggcaccgacgcgggcggctcgatggcg
gaccggctcagcctcgccgacggcgacaccgcaggcggctccgccggggcgggggacccg
ggcggcggcgcggcgggcgcggaatccgggcgcggcaccgcggagcaccccgccgacggc
ccggaaaccggcgccgacgagctgtcggccgccgacccgggcggcgcggggagcggcccc
ggcgccggttcggccgaggagaacagctgggtcgagcccacgctggccggcctgtcgctg
gagcagcgcgtaggccagatgatgatgggatacgtcttcggtaccgcgggcgccgaccgg
agcccggccgttgtcaccgcgaaccggcggacgtccggtgtggacacggccgccgaagcc
gtcgcgagacggggcctgggcggcgtgatctacttcgacgccggcgggacgggcccgggg
gcgctcccggacaacatcgtcaacccgaaccaggtcaagacgctgtccgcggacctgagc
gcggcggccagcatcccgctgctgatcgccgcggaccaggagcagggaacggtgctgcgc
gtccgggacggcgtgaccctgctgcccggccagatggcacagggcgcgacgggacgtccc
accgacgcgcgggacgccgcgcagatcaccggcgcggacctgcgcgccctgggcatcaac
gtcgacttcgccccggacgcagacgtcaacagcgacccggcgaaccccgtgatcggtgag
cgctccttcggcgacgaccctacggcggtcgggcggttcaccgcggcggcggtcgaggga
taccggcaggtcggggtggccgcggccgcgaaacactttcccgggcacggcgcgacgtcc
gtcgacagccacgccgacctgccgacgatcaccagagaccgggcggcgctgacggcgctc
gacctgccgccgttccgggcggcgatcgccgcgggcgtaccgatggtcatggtcggtcat
ctgaacgtccccgcgctcgacccggccgcgccggcgacgctgtcgaagccggtggtcgac
ggcctgctgcgccacgagctcggcttcgacggcgtcatcgtcaccgacgcgctgaacatg
gccgcgatcaccgagcacaacacgcccggcggcgcggcggtgcgagccgtccaggccggc
gtcgacatgctgctgatgccgccggacctgacgcaggcgcttgatgctgtggtttccgct
gtgcgctccggggcgatcgttccggagcggatcgacgcctcggtacgtcgaatcctgagg
atgaagtggaggctggcgcacaccgagcccgccgcggcccgaacccccgaggaggcggcg
gccaccgcggccgcgatcgccgagcgggcgatcacgctccttgaccagccgacgtgtgac
ctgctcccgctcagccgcggcaccgccggcgccggtgcgggcgggacgcagccggcggtg
gaggtctccgggccgtcgggcgccgcgaagatgctcgtggacgcactgggtgcccggggg
atcggcgcccggttggccgcccagggctccggccgcccgccagcgccgcccgcagcgggc
gcctcgggagcgggtacggctgtggtccgggtggtgctggtcgggaactcgccgccgccc
gtcaccgaccggcggaccgtggtcgtgtcgaccgggacgccctaccgtccgccggtggcc
gccggggcgtggctggcgagctattcacgcgacccagcgtcgatgaaggcgctggcggcg
gtgctggccggcgcggtgccaccctccggccggctgccggtcgtcacccgaaccgcgacc
ggcaccgcgttgccgcgcggcgcaggcctaccgaccccgcgcgcctgctga

DBGET integrated database retrieval system