KEGG   Frankia sp. EAN1pec: Franean1_5309Help
Entry
Franean1_5309     CDS       T00608                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
fre  Frankia sp. EAN1pec
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Franean1_5309
Enzymes [BR:fre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Franean1_5309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(6391333..6393675)
Genome map
AA seq 780 aa AA seqDB search
MTSAPERPDQPAAPPAATAPPTTAAPSAAAPSAGGAVGAGGQQGPASVWSGLGDLKALAA
EFGVATSYDGQDGTPVTVQPRAVRAALGLLGVDPSDPAVALAGAREARRRRPLPPCAVVR
AQAPAPVAVHVPDAAADAVTAEAVLAGGESVPLSVGLRGAVGEVDGHAVRAGTVDLPSGL
PLGDHRLRLSFGGSTTECPLIVVPERVPDFAAAPSPAEATGRAWGWMIQLYALTSAGSWG
MGDYADLATLAEWSARDGADVLLVNPLHAVAPTFPVEPSPYSPASRRFVSPLYLRPELTP
EYRHASETVRAEVDRLAGVARREGIRDGLIDRDAVWRAKLAAVELLFTSSGGGTGDGPAG
GQEADGALRDFALWCALAERHGRDWRTWPEDLRDPAGPAVDAARAELAERVAFHVWLQRR
CDDQLGAAQAAARTAGMRVGIVHDLAVGVDPGGADAWAMRGVLATGASVGAPPDGFNQQG
QDWGLPPWRPDVLAESGYAPFRAMVAAVLSRGGGLRVDHILGLFRLWWVPDGAGAAGGTF
VRYDAEALLGLLALEAHRAGALVVGEDLGTVEPSVAEALDGAGIFGSSVLWFEQAADGSP
LPPREYRARTMASVTTHDLPTAAGFLEGEHVRVRARLGLLARTDEQERAAWLAERAGLLR
LLADEGLVSPPAGVVAEEDRLEPELRAAAALGLHVLLARSRARIVLVAPGDAFGDVRQPN
LPGTVDSYPNWRLPVVDDAGERVTVERLITDPRSRRMVEALEALGAITADRAGATTTRRP
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
gtgacatccgcgcccgagcgccccgaccagcccgccgcgccccccgccgctaccgcgccg
cctaccactgcggcgccgtcagccgccgcgccgtcagccggcggcgcggtcggagccggt
gggcagcagggcccggcgtcggtctggtccgggctcggtgacctcaaggccctcgccgcc
gagttcggggtggccacgtcctacgacgggcaggacggcacgccggtcacggtgcagccg
agggccgtccgggcggcgctgggcctgctcggcgtcgacccgtcggacccggccgtcgcg
ctcgccggggcacgcgaggcgcgtcggcggcgcccgctgcccccgtgtgcggtcgtccgg
gcgcaggcccccgcgccggtcgccgtgcacgtgccggatgccgccgcggacgccgtcacc
gccgaggccgtgctggccggcggggagagcgtgccgctgtcggtcgggctgcgcggcgct
gtcggggaggtcgacggccatgccgtccgcgcgggcacggtggacctgccgtccggcctg
ccgctcggggatcaccgcctgcggctgagcttcggcgggagcaccaccgagtgcccgctg
atcgtcgtcccggagcgcgtgcccgacttcgcggccgccccgagcccggccgaggccacc
gggcgggcctggggctggatgatccagctgtacgcgctcacctccgcgggatcgtggggg
atgggcgactacgccgacctcgccaccctcgccgagtggtccgcgcgtgacggcgccgac
gttctgctggtgaacccgctgcacgcggtggcgccgacctttccggtcgagccgtcgccg
tactcgccggcgagccgccgcttcgtctcaccgctctacctgcggcccgagctgaccccg
gagtaccggcacgcctccgagacggtgcgggcggaggtcgaccggctggcgggagtcgcc
cgccgggaggggatcagggacggcctgatcgaccgggacgcggtgtggcgggccaagctc
gccgccgtcgagctgctgttcacctcgtccggcggcgggacgggcgacgggccggccggt
gggcaggaggccgatggcgcgctgcgcgacttcgcgctctggtgcgcgctcgccgagcgg
cacggccgggactggcgcacctggccggaggacctgcgcgatcccgccgggccggcggtc
gacgccgcgcgcgccgagctggcggagcgcgtcgcgttccatgtctggctgcagcggcgg
tgcgacgaccagctcggcgcggcgcaggccgccgccaggacggcggggatgcgggtcggc
atcgtccacgatctcgctgtcggggtcgatccgggcggcgcggacgcctgggcgatgcgc
ggcgtgctggccaccggggcctccgtcggcgccccgccggacggcttcaaccagcagggc
caggactggggcctcccgccgtggcggcccgacgtcctcgcggagagcgggtatgccccg
ttccgggcgatggtcgccgcggtgctgtcccggggcggcgggctacgggtggatcacatt
ctcgggctgttccgcctgtggtgggtcccggacggcgccggcgccgccggcggcactttc
gtccgctacgacgccgaggcgctgctggggctgctcgccctcgaggcgcaccgggccggc
gccctggtcgtcggtgaggatctcggcaccgtcgagccgtcggtggccgaggcgctcgac
ggcgccgggatcttcggctcctcggtgctgtggttcgagcaggcggcggacggctccccg
ctcccgccgcgcgagtaccgggcccggaccatggccagcgtgaccacgcacgacctgccc
accgccgccggcttcctcgagggcgagcacgtgcgcgtgcgcgcgcggctcggcctgctc
gcccgcaccgacgagcaggaacgcgccgcctggctcgccgaacgcgccggactgctgcgg
ctgctcgccgacgagggcctggtgagcccgccggcgggggtcgtggcggaggaggatcgc
ctcgaaccggagctgcgtgcggcggccgcgctcggcctgcacgtcctgcttgcccggtca
cgcgcgcggatcgtgctggtcgctcccggtgacgcgttcggcgacgtccgtcagccgaac
ctgcccggcacggtcgacagctatccgaactggcggctaccggtcgtcgacgacgccggg
gagcgcgtcaccgtcgaacggctgatcaccgatccccggtcgcgccggatggtcgaggca
ctcgaggcactcggggcgatcaccgccgatcgggcgggagccaccaccacccggcgcccc
tga

DBGET integrated database retrieval system