KEGG   Frankia sp. EAN1pec: Franean1_5671Help
Entry
Franean1_5671     CDS       T00608                                 

Definition
putative agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
fre  Frankia sp. EAN1pec
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Franean1_5671
Enzymes [BR:fre01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Franean1_5671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(6884321..6885430)
Genome map
AA seq 369 aa AA seqDB search
MCMAQAGDRDVARERGSAGPVPPYAARAAGADDPGADAPGYSGLATFAGLPWMPGLGDLR
ARRPDVAVVGAPFDIATTHRPGARFGPRALRAQAYNPGTYHLDLGIEIFDWLDVVDAGDA
HCPHGLTEVSHRNIRAKVGDVARLGVIPVIIGGDHSITWPAASGVAEAVGWGEVGLLHFD
AHADTADIIDGNLASHGTPMRRLIESGAVRGRNFVQVGLRGYWPPPDVFAWMREQGMRWH
LMHEIWERGSREVVAEAIAQAVDGCRALYLSVDIDVLDPGFAPGTGTPEPGGMNPADLLR
AVRQIALDTPIVAADIVEVSPPYDHAETTVNSAHRVAMEIFAALAHRRRSAAGGTADLPA
GLPKAKAGS
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgtgcatggcacaggccggcgatcgggacgtggcacgcgagcgggggagcgccggtccg
gtgccgccgtacgcggcgcgggccgcgggagcggacgatcccggcgcggacgccccggga
tactccggcctggcgaccttcgccggtctgccctggatgccgggactcggcgatcttcgg
gcgcgccggcccgatgtcgctgtggtcggggctccgttcgacatcgcgaccacgcaccgg
ccgggcgcgcgtttcggcccgcgggcgctgcgcgctcaggcgtacaaccctggcacatat
catcttgatcttggtatagagatctttgactggctggacgtcgttgacgcgggggacgcg
cactgcccgcacgggctgaccgaggtctcacatcgcaacatccgggcgaaggtcggcgac
gtcgcgcggctcggcgtcatcccagtgatcatcgggggggaccactcgatcacctggccg
gcggctagcggggtcgccgaggcggtgggctggggtgaggtcggcctgctgcacttcgac
gcccacgccgacacggccgacatcatcgacgggaacctggcctcgcacgggacgcctatg
cggcggctcatcgagtcgggggcggtgcgcgggcgcaacttcgtccaggtggggctgcgc
gggtactggcctccgccggacgtgttcgcgtggatgcgcgagcagggtatgcgctggcac
ctgatgcacgagatctgggagcgggggagccgagaggtggtcgccgaggcgatcgcgcag
gcggtggacggctgccgcgcgctctacctgtcggtcgacatcgacgtcctcgacccgggg
ttcgcgcctgggacgggcacccccgagccgggcggcatgaacccggccgacctgttgcgg
gccgtgcggcagatcgcgctggacacgccgatcgtcgccgcggacatcgtcgaggtctcg
cctccgtacgaccacgcggagacgacggtgaacagcgcgcaccgggtcgcgatggagatt
ttcgcggcgttggcgcatcgccgccgtagcgcggccggtgggacggcggaccttcccgcg
gggctcccgaaggcgaaagctgggtcttga

DBGET integrated database retrieval system