KEGG   Frankia sp. EAN1pec: Franean1_5869Help
Entry
Franean1_5869     CDS       T00608                                 

Definition
F420-0--gamma-glutamyl ligase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
fre  Frankia sp. EAN1pec
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:fre00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
7122275..7123855
Genome map
AA seq 526 aa AA seqDB search
MSDLSPVGTSMTKDGPEPAEASFPGVAAPEAEGPPPVGGEAPAGEPPAAEDALPAEQSEK
FENFEKSDEQVGTGAAEQVGEEPLAERELRILPLGGIGEVRPGDDLAALIAVAAATGAGP
GGGPGLRDGDVLVVTSKIVSKAEDRLIRIEGDREATRQAAIDAESVREVARRGPTRIVET
HHGLVLASAGVDASNIAKDSIALLPVDPDTSARTLRDGLRDRLGVDVAVIISDTAGRPWR
RGLTDMAIGVAGMAALRSHIGDVDSYGNELGMTEIAEADELAGAADLVKGKLGATPVAIV
RGFARRPDDGSGSRALLRPWDEDMFQLGTVEARRSAPFARRTVREFADLPVDPAAVHQAI
AAAITAPAPHHTTPWRFVLVEARRHALLDAMAMAWTDDLRRDGFDEDSVSRRLRRGDVLR
RAPVLIVPMMVTDGAHPYPDERRVRAEERMFTVALGAAVQNLLVALAAEGLGSCWVSSAL
FCGEVVTDTLDLPRTWTPMGVVGVGHPAAPAHPRPARDIAAFVVER
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgacctgtccccggtggggacatccatgacgaaggacggaccggaacccgcggag
gcgtcgttcccgggcgtcgccgcacccgaggcggaaggtccgcccccggtcggtggcgaa
gccccggccggggaacctcccgcggcggaggacgcgctgccggccgagcagtccgagaag
ttcgagaacttcgagaagtccgacgagcaggtcggcacgggcgcggcggagcaggtcggc
gaggagccgctggcggagcgggagctgcggattctgccgctgggcgggatcggcgaggtg
cggccgggcgacgacctcgccgcgctgatcgccgtggccgcggccacgggcgccgggccc
ggaggcggccccgggctgcgtgacggtgacgtcctcgtcgtgacgtccaagatcgtgtcg
aaggccgaggaccggctgatccggatcgaaggcgacagagaggccacgcgccaggccgcc
atcgacgccgagtccgtgcgtgaggtcgcgcgccgcggcccgacccgcatcgtcgagacg
caccacggcctcgtgctggcgagcgcgggggtggacgcgtccaacatcgcgaaggactcg
atcgcgctgctgccggtcgaccccgataccagtgcccgcacgctgcgggacggcctgcgc
gaccggctcggcgtcgacgtcgcggtgatcatcagcgacacggccgggcggccctggcgg
cgcgggctgaccgacatggcgatcggcgtcgccgggatggcggcgctgcgcagccacatc
ggcgacgtcgactcctacggcaacgagctcgggatgaccgagatcgccgaggccgacgag
ctggccggcgcggcggacctggtgaagggcaaactcggcgccacgccggtggcgatcgtc
cgcgggttcgcgcgccggcccgacgacgggagcgggtcacgcgcgctgctgcggccctgg
gacgaggacatgttccagctcggcacggtcgaggcacgccgctcggccccgttcgcgcgg
cgcacggtgcgggagttcgccgacctcccggtcgacccggcggcggtgcaccaggcgatc
gccgcggcgatcaccgcgcccgccccgcaccacaccacaccatggcggttcgtgctggtc
gaggcgcgccggcacgccctgctcgacgcgatggcgatggcctggacggacgacctgcgc
cgcgacgggttcgacgaggactcggtgagcaggcggctgcgccgcggcgacgtgctgcgc
cgggcgccggtgctgatcgtcccgatgatggtgaccgacggcgcgcatccctacccggac
gagcgtcgggtgcgggccgaggagcggatgttcaccgtggcgctcggcgccgccgtgcag
aacctgctggtcgccctcgcggccgagggcctgggctcgtgctgggtgtcgtccgcgctg
ttctgcggggaggtcgtgaccgacacgctggacctgccgcgcacctggacgccgatgggc
gtcgtgggtgtggggcacccggccgcaccggcgcacccgcggccggcccgtgacatcgcg
gcgttcgtcgtggagcgctga

DBGET integrated database retrieval system