KEGG   Frankia sp. EAN1pec: Franean1_5934Help
Entry
Franean1_5934     CDS       T00608                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
fre  Frankia sp. EAN1pec
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Franean1_5934 (deoA)
Enzymes [BR:fre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Franean1_5934 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(7207246..7208580)
Genome map
AA seq 444 aa AA seqDB search
MSADAPGSDHGGPAASHDVVDLIRAKRDGAALPADAVAWLIDAYTHGRVADEQMSAYLMA
VVWRGMASDELDHWTSAMIASGERLDLSGLTRPTVDKHSTGGVGDKVSLVLAPLVAACGA
AVPQLSGRGLGHTGGTLDKMEAIPGWRADLDPGTMRAVLADVGAVICAAGPGLAPADRRL
YALRDVTGTVESIPLIASSIMSKKIAEGTSALVLDVKVGAGAFMTSLADARELARTMVGL
GARAGVRTEALLTAMDTPLGRTAGNGPEVTEAVETLRGAGPSDLVEVTVALARVMLDIVG
LSGGSGAAPDPAEVLASGAAYDVWRAMVAAQGGDPDAPLPTAAFTRTVSAPADGYLSRLD
ARALGIAAWRLGAGRARKEDPVSPAAGLRWLAAVGEQVQAGAPLIELYSDDEATFPRALS
ALADAVSVTDEPPPPTPLILDHIR
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctgatgcccccggcagcgatcacggcggtcctgcggcgtcccacgacgtcgtc
gacctcatccgggccaagcgcgacggggcggcgctgccggcggacgcggtcgcctggctc
atcgacgcctacacccacggccgggtcgccgacgagcagatgtccgcctacctgatggcc
gtggtctggcgcggcatggcctccgacgaactggatcactggacgtcggcgatgatcgcc
agcggcgaacggctggacctgtccggcctgacccgcccgacggtcgacaagcattccacc
ggcggggtcggggacaaggtctcgctggtcctcgccccgctggtggccgcgtgcggagcg
gccgtcccgcagctgtccggacgtgggctcgggcacaccggcgggacgcttgacaaaatg
gaggcgatccccggctggcgcgccgatctcgacccgggcaccatgcgtgccgtgctggcg
gacgtcggcgccgtcatctgcgccgccggccccggcctggctcccgcggaccgcaggctg
tacgccctgcgcgacgtcaccggcacggtcgagtccatcccgctgatcgcctcctcgatc
atgagcaagaagatcgcggaggggacgtccgcgctggtcctggacgtcaaggtcggcgcc
ggcgccttcatgacctcactcgccgacgcccgcgagctcgcgcggacgatggtcggcctg
ggcgcccgcgccggggtgcgcaccgaggccctgctcaccgcgatggacaccccgctgggc
cgcaccgcgggcaacggccccgaggtgaccgaggcggtcgagaccctgcgcggggcgggc
ccgtcggacctcgtcgaggtgaccgtcgccctcgcccgcgtcatgctggacatcgtcggc
ctcagcggtggttccggtgccgcgccggatccggcggaggtcctggcctccggggcggca
tacgacgtgtggcgcgcgatggtcgccgcccagggcggcgatccggacgccccgctgccg
accgccgcgttcacccgcactgtctccgctccggcggacggctacctgagccgcctcgac
gcccgcgccctgggcatcgccgcctggcgcctgggcgcggggcgcgcgcggaaggaagat
cccgtctcgccggcagctggactgcgttggctggcggcggtgggggagcaggtccaggcc
ggcgcccccctgatcgagctctactccgacgacgaggcgaccttcccccgcgcgctctcc
gcactcgcggacgccgtctcggtcaccgacgagccgccccctcccacccccctgatcctc
gaccacatccgctga

DBGET integrated database retrieval system