KEGG   Frankia sp. EAN1pec: Franean1_5980Help
Entry
Franean1_5980     CDS       T00608                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
fre  Frankia sp. EAN1pec
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Franean1_5980
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Franean1_5980
   00640 Propanoate metabolism
    Franean1_5980
   00660 C5-Branched dibasic acid metabolism
    Franean1_5980
Enzymes [BR:fre01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Franean1_5980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(7286403..7287569)
Genome map
AA seq 388 aa AA seqDB search
MDLFEYQAKKLFAEHGVPVPTGKIATTPQQAREIATELGGKVVVKAQVKAGGRGKAGGVK
VADGPDDAFEKASAILGMDIKGHTVHSVLVEQASNIAEEYYASFLLDRANRTFLAMASRE
GGMEIEEVAATNPEALARIHIDPLTGVDAAKAREIAVAAKLPEAAIEGASVLLVKLWEVF
VKADATLVEVNPLILTGDGKVIALDGKVTLDENADFRHPENAELVDVAAVDPLEQKAKEK
GLNYVKLEGQVGIIGNGAGLVMSTLDVVTYAGEEFGGQRPANFLDIGGGASAEVMANGLS
IILSDPSVKSVFVNIFGGITACDAVANGIVQALAIVGDVSTPLVVRLDGNNAEEGRRILK
EANLPVVKPVDTMDGAAKLAAELAAAAA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtggatctcttcgaataccaggcgaagaagcttttcgccgaacatggcgtaccggtaccc
accgggaagattgccacaaccccccaacaggcacgtgagatcgcgaccgagctcggcggc
aaggtggtcgtcaaggctcaggtcaaggccggaggccgaggcaaggccggcggcgtgaag
gtcgccgacgggcccgacgacgcgttcgagaaggcgtcggcgatcctggggatggacatc
aagggccacacggtccactccgtcctcgtcgagcaggccagcaacatcgcggaggagtac
tacgcctccttcctgctcgaccgggcgaaccgcacgttcctcgcgatggcctcccgtgag
ggcggcatggagatcgaggaggtcgcggccaccaacccggaggcgctcgcgcgcatccac
atcgacccgctgaccggcgtggacgcagccaaggcccgcgagatcgccgtcgctgccaag
ctgcccgaggccgccatcgagggtgcgtccgtgctgctggtgaagctgtgggaggtgttc
gtcaaggccgacgccacgctggtcgaggtgaacccgctcatcctgaccggcgacggcaag
gtcatcgcgctcgacggcaaggtgaccctggacgagaacgcggatttccggcacccggag
aacgccgagctcgtcgacgtcgccgcggtcgacccgctggagcagaaggccaaggagaag
ggcctcaactacgtcaagctcgagggccaggtcgggatcatcggcaacggtgccggcctc
gtcatgtcgacgctggacgtcgtgacctacgccggtgaggagttcggtggccagcggccg
gcgaacttcctcgacatcggcggtggcgcctcggccgaggtgatggcgaacggcctgtcg
atcatcctgagcgacccgtccgtgaagagcgtcttcgtcaacatcttcggcgggatcacg
gcctgtgacgccgtcgcgaacggcatcgtccaggcgctcgccatcgtcggggacgtcagc
accccgctggtggtgcgtctcgacggcaacaacgccgaggagggccgccggatcctgaag
gaggccaacctcccggtggtcaagccggtggacacgatggacggcgcagcgaagctcgcc
gccgagctcgccgcggccgcggcctga

DBGET integrated database retrieval system