KEGG   Frankia sp. EAN1pec: Franean1_5980Help
Entry
Franean1_5980     CDS       T00608                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
fre  Frankia sp. EAN1pec
Pathway
fre00020  Citrate cycle (TCA cycle)
fre00640  Propanoate metabolism
fre00660  C5-Branched dibasic acid metabolism
fre01100  Metabolic pathways
fre01110  Biosynthesis of secondary metabolites
fre01120  Microbial metabolism in diverse environments
fre01130  Biosynthesis of antibiotics
fre01200  Carbon metabolism
Module
fre_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fre_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Franean1_5980
   00640 Propanoate metabolism
    Franean1_5980
   00660 C5-Branched dibasic acid metabolism
    Franean1_5980
Enzymes [BR:fre01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Franean1_5980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABW15324
RhizoBase: Franean1_5980
UniProt: A8LAW3
Position
complement(7286403..7287569)
Genome map
AA seq 388 aa AA seqDB search
MDLFEYQAKKLFAEHGVPVPTGKIATTPQQAREIATELGGKVVVKAQVKAGGRGKAGGVK
VADGPDDAFEKASAILGMDIKGHTVHSVLVEQASNIAEEYYASFLLDRANRTFLAMASRE
GGMEIEEVAATNPEALARIHIDPLTGVDAAKAREIAVAAKLPEAAIEGASVLLVKLWEVF
VKADATLVEVNPLILTGDGKVIALDGKVTLDENADFRHPENAELVDVAAVDPLEQKAKEK
GLNYVKLEGQVGIIGNGAGLVMSTLDVVTYAGEEFGGQRPANFLDIGGGASAEVMANGLS
IILSDPSVKSVFVNIFGGITACDAVANGIVQALAIVGDVSTPLVVRLDGNNAEEGRRILK
EANLPVVKPVDTMDGAAKLAAELAAAAA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtggatctcttcgaataccaggcgaagaagcttttcgccgaacatggcgtaccggtaccc
accgggaagattgccacaaccccccaacaggcacgtgagatcgcgaccgagctcggcggc
aaggtggtcgtcaaggctcaggtcaaggccggaggccgaggcaaggccggcggcgtgaag
gtcgccgacgggcccgacgacgcgttcgagaaggcgtcggcgatcctggggatggacatc
aagggccacacggtccactccgtcctcgtcgagcaggccagcaacatcgcggaggagtac
tacgcctccttcctgctcgaccgggcgaaccgcacgttcctcgcgatggcctcccgtgag
ggcggcatggagatcgaggaggtcgcggccaccaacccggaggcgctcgcgcgcatccac
atcgacccgctgaccggcgtggacgcagccaaggcccgcgagatcgccgtcgctgccaag
ctgcccgaggccgccatcgagggtgcgtccgtgctgctggtgaagctgtgggaggtgttc
gtcaaggccgacgccacgctggtcgaggtgaacccgctcatcctgaccggcgacggcaag
gtcatcgcgctcgacggcaaggtgaccctggacgagaacgcggatttccggcacccggag
aacgccgagctcgtcgacgtcgccgcggtcgacccgctggagcagaaggccaaggagaag
ggcctcaactacgtcaagctcgagggccaggtcgggatcatcggcaacggtgccggcctc
gtcatgtcgacgctggacgtcgtgacctacgccggtgaggagttcggtggccagcggccg
gcgaacttcctcgacatcggcggtggcgcctcggccgaggtgatggcgaacggcctgtcg
atcatcctgagcgacccgtccgtgaagagcgtcttcgtcaacatcttcggcgggatcacg
gcctgtgacgccgtcgcgaacggcatcgtccaggcgctcgccatcgtcggggacgtcagc
accccgctggtggtgcgtctcgacggcaacaacgccgaggagggccgccggatcctgaag
gaggccaacctcccggtggtcaagccggtggacacgatggacggcgcagcgaagctcgcc
gccgagctcgccgcggccgcggcctga

DBGET integrated database retrieval system