KEGG   Frankia sp. EAN1pec: Franean1_6129Help
Entry
Franean1_6129     CDS       T00608                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
fre  Frankia sp. EAN1pec
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Franean1_6129
Enzymes [BR:fre01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Franean1_6129
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Franean1_6129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(7457150..7458964)
Genome map
AA seq 604 aa AA seqDB search
MATRRTKKPVSPVALVGAGPRDPGLLTVLAVETLTAADVVVADPDVPSEVVESLSAEVLR
IGDLDAPKPVRDAEAATAAVVSRARAGDKVVRLYASDPWLTRIGAADAQSLAKAKIPYRV
VPGISTSAAVATYAGVAPGSPVTFASTSGVFSSSGSVASASPFGVGDPVGPLTPPPFGTS
RLGGRSMPSLGGGPLGVGGGFGAPLGLGTPTGFGGLGVPTTPGDVDWGALAQAPGTLIVT
AGPTEIGKVATALVEHGRAGDTPVAVTVDGTTTDQRTVTSTLDRIEADVAPMLNATANPP
NEVIISVGPVVATRAKLSWWETRALFGWTVLVPRTKEQAAILSDSLRAHGASPLEVPTIA
VEPPRTAAPMERAITGLVSGRYQWVAFTSVNAVKAVQEKVEERSLDARAFAGVKVAAIGE
ATADALRAFGIRPDLVPAGQQSSEGLLEDWPEFDESLDLLDRVLLPRADIATDTLVAGVK
DRGWQVDDVTAYRTVRAAPPPAPIREALKGGRVDAVVFTSSSTVRNLVGIAGKPHETTVI
AVIGPATAATAQELGLRVDVQATEASIPSLVASLAEFAAEHREELGKVGPLAARLPKPRR
GSRR
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggccacccgacgtaccaagaagcccgtgtccccggtcgcgcttgtgggcgccggtccc
cgtgatccggggctgctcacggtcctcgccgtggagactctcaccgctgccgacgtggtg
gtcgccgacccggacgtaccgtccgaggtggtcgagtcgctgtcggccgaggtgctgcgg
atcggtgacctcgacgccccgaagccggtgcgggacgcggaggccgcgaccgccgcggtc
gtcagccgggcacgggccggggacaaggtcgtccggctctacgcctcggacccgtggctg
acccggatcggcgcggcggacgcgcagtcgctggccaaggccaagatcccctaccgggtg
gttcccggtatctcgacctccgccgcggtcgcgacctacgccggtgtcgcgccgggcagc
ccggtcaccttcgccagcacgtcgggtgtcttctcgtcctcgggctcggtcgcctcggcc
tcaccgttcggcgtcggtgacccggtcggcccgctcaccccgccccccttcgggacgtcc
cgcctcggcggccggtcgatgccgagcctcggcggcggcccgctgggcgtgggcggcggc
ttcggcgcgcccctcggcctgggcacccctaccggcttcggtggtctcggcgtgcccacc
acgccgggcgacgtcgactggggcgcgctcgcgcaggcccccggcacgctgatcgtcacc
gccggccccaccgagatcggcaaggtggcgaccgcgctggtcgagcacggccgcgccggt
gacacccccgtcgcggtcaccgtcgacggcacgaccaccgaccagcgcaccgtcacctcg
accctcgaccggatcgaggccgacgtcgcgccgatgctcaacgccaccgcgaacccgccg
aacgaggtcatcatctccgtcggcccggtcgtcgcgacccgggcgaagctgtcctggtgg
gagacccgcgccctgttcggctggacggtgctggtgccccggacgaaggaacaggcggcg
atcctctccgactcgctgcgcgcccacggggcgagtccgctggaggtgccgacgatcgcc
gtcgagccgccgcggacggccgcgccgatggagcgcgccatcaccgggctggtctccggc
cgctaccagtgggtcgccttcacctcggtgaacgccgtcaaggcggtgcaggagaaggtc
gaggagcgcagcctggacgcccgcgccttcgccggtgtcaaggtcgccgcgatcggcgag
gccaccgcggacgcgctgcgcgccttcggtatccgccccgacctggtgcccgccggccag
cagtccagcgagggcctgctcgaggactggcccgagttcgacgagtcgcttgacctgctc
gaccgggttctcctgccgcgcgccgacatcgccaccgacactctcgtcgccggcgtcaag
gaccgcggctggcaggtggacgacgtcaccgcctaccggacggtgcgcgccgcgccgccg
cccgcgccgatccgcgaggccctcaagggcggccgggtcgacgcggtggtcttcacctcc
tcctccacggtgcgcaacctggtcggaatcgccggcaagccgcacgagaccaccgtcatc
gcggtgatcggcccggcgacggccgcgaccgcccaggagctcggcctgcgggtggacgtc
caggcgaccgaggcgtcgatcccgtcgctcgtcgcgtcgctggcggagttcgccgccgag
caccgcgaggagctcggcaaggtcggcccgctcgccgccaggctgcccaagccgcgccgg
ggttcccggcgatga

DBGET integrated database retrieval system