KEGG   Frankia sp. EAN1pec: Franean1_6148Help
Entry
Franean1_6148     CDS       T00608                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
fre  Frankia sp. EAN1pec
Pathway
fre00010  Glycolysis / Gluconeogenesis
fre00260  Glycine, serine and threonine metabolism
fre00680  Methane metabolism
fre01100  Metabolic pathways
fre01110  Biosynthesis of secondary metabolites
fre01120  Microbial metabolism in diverse environments
fre01130  Biosynthesis of antibiotics
fre01200  Carbon metabolism
fre01230  Biosynthesis of amino acids
Module
fre_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fre_M00002  Glycolysis, core module involving three-carbon compounds
fre_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Franean1_6148
  Energy metabolism
   00680 Methane metabolism
    Franean1_6148
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Franean1_6148
Enzymes [BR:fre01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Franean1_6148
Membrane trafficking [BR:fre04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Franean1_6148
Exosome [BR:fre04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Franean1_6148
  Exosomal proteins of melanoma cells
   Franean1_6148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABW15492
RhizoBase: Franean1_6148
UniProt: A8LDI4
Position
complement(7480340..7481077)
Genome map
AA seq 245 aa AA seqDB search
MPTLVLLRHGESTWNRENLFTGWVDVDLSEKGLKEATRGGELLQEAGVLPDVVHTSLLTR
AIRTAWLALDAAGRTWVPVRRSWRLNERHYGGLQGLNKAETLAKFGDEQFLLWRRSYDTP
PPPIEPGQPSGVDERYADLAPDVIPLTECLRDVVVRMLPYWYDSIVPDLRSGATVLVTAH
GNSLRALVKHLDGISDTDIANLNIPTGIPLRYELDDDLKVLDSGYLDPAAAETAAAAVAA
QGKKK
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgctcgtcctgctccgccacggcgagagcacgtggaaccgtgagaacctgttc
accggctgggtggacgtcgatctgtccgagaagggcctcaaggaggccacgcgcggcggg
gagctgctccaggaggcgggcgtcctgcccgacgtggtgcacacctcgctgctcacccgg
gccatccgcaccgcgtggctcgccctggacgcggccggccgcacctgggtgccggtgcgc
cgcagctggcgtctcaacgagcggcactacggcggcctgcaggggctgaacaaggcggag
accctggcgaagttcggcgacgagcagttcctgctctggcgccgctcctacgacacgccg
ccgccgcccatcgagccgggccagccgagcggcgtcgacgagcggtacgccgacctcgct
cccgatgtgatcccgctcaccgaatgcctgcgcgacgtcgttgtccggatgctgccctac
tggtatgactcgatcgtcccggacctgcgctccggcgcgacggtgctcgtcacggcgcac
gggaactcgctgcgggcgctggtcaagcacctcgacgggatctccgacaccgacatcgcg
aacctgaacatcccgaccggcatcccgctgcgctacgagctggacgacgatctcaaggtg
ctggactcgggctatctcgacccggccgcggcggagaccgccgccgcggccgtcgcggct
cagggcaagaagaagtag

DBGET integrated database retrieval system