KEGG   Frankia sp. EAN1pec: Franean1_6566Help
Entry
Franean1_6566     CDS       T00608                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
fre  Frankia sp. EAN1pec
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:fre03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
7988254..7988853
Genome map
AA seq 199 aa AA seqDB search
MYEGIVQDVIDELGQLPGIGPKSAQRIAFHLLAADPADVRRLASALTELKEKVRFCRICF
NVAQSELCRICSDPRRDPTSICVVEESKDVVAIERTREFRGKYHVLGGAINPIGGVGPDD
LHIRELVARLADGTVTEIILATDPNTEGEVTASYLARQIGPMGLTVTRLASGLPMGGDLE
WADEVTLGRAFEGRRIVSA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgagggcatcgtccaggatgtgatcgacgagctggggcagctcccggggatcggt
cccaagagcgcgcagcgcatcgcgttccatctgctcgccgcggacccggccgatgtccgc
cggctcgccagcgcgttgaccgagctgaaggaaaaggttcggttctgccggatctgcttc
aacgtggcccagtcagagctgtgccggatctgttccgacccgcggcgtgatccgacgtcc
atctgcgtggtcgaggagtcgaaggacgtcgtcgcgatcgagcggacccgtgagttccgc
ggcaagtaccacgtcctcggcggggccatcaatccgatcggcggtgtggggccggacgac
ctgcacatccgcgaattggtggcccgcctcgccgacgggaccgtcaccgagatcatcctg
gcgacggatccgaacaccgagggcgaggtgacggcgtcctacctggcccgccagatcggc
ccgatgggcctgaccgtcacccgcctggcgagcgggctgccgatgggcggcgatctggag
tgggccgacgaggtcacgctcggccgcgccttcgagggccggcggatcgtcagcgcctga

DBGET integrated database retrieval system