KEGG   Frankia sp. EAN1pec: Franean1_6566Help
Entry
Franean1_6566     CDS       T00608                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
fre  Frankia sp. EAN1pec
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fre00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Franean1_6566 (recR)
DNA repair and recombination proteins [BR:fre03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Franean1_6566 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
7988254..7988853
Genome map
AA seq 199 aa AA seqDB search
MYEGIVQDVIDELGQLPGIGPKSAQRIAFHLLAADPADVRRLASALTELKEKVRFCRICF
NVAQSELCRICSDPRRDPTSICVVEESKDVVAIERTREFRGKYHVLGGAINPIGGVGPDD
LHIRELVARLADGTVTEIILATDPNTEGEVTASYLARQIGPMGLTVTRLASGLPMGGDLE
WADEVTLGRAFEGRRIVSA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgagggcatcgtccaggatgtgatcgacgagctggggcagctcccggggatcggt
cccaagagcgcgcagcgcatcgcgttccatctgctcgccgcggacccggccgatgtccgc
cggctcgccagcgcgttgaccgagctgaaggaaaaggttcggttctgccggatctgcttc
aacgtggcccagtcagagctgtgccggatctgttccgacccgcggcgtgatccgacgtcc
atctgcgtggtcgaggagtcgaaggacgtcgtcgcgatcgagcggacccgtgagttccgc
ggcaagtaccacgtcctcggcggggccatcaatccgatcggcggtgtggggccggacgac
ctgcacatccgcgaattggtggcccgcctcgccgacgggaccgtcaccgagatcatcctg
gcgacggatccgaacaccgagggcgaggtgacggcgtcctacctggcccgccagatcggc
ccgatgggcctgaccgtcacccgcctggcgagcgggctgccgatgggcggcgatctggag
tgggccgacgaggtcacgctcggccgcgccttcgagggccggcggatcgtcagcgcctga

DBGET integrated database retrieval system