KEGG   Frankia sp. EAN1pec: Franean1_6571Help
Entry
Franean1_6571     CDS       T00608                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding type 2
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
fre  Frankia sp. EAN1pec
Pathway
fre00010  Glycolysis / Gluconeogenesis
fre00071  Fatty acid degradation
fre00350  Tyrosine metabolism
fre00625  Chloroalkane and chloroalkene degradation
fre00626  Naphthalene degradation
fre01100  Metabolic pathways
fre01110  Biosynthesis of secondary metabolites
fre01120  Microbial metabolism in diverse environments
fre01130  Biosynthesis of antibiotics
fre01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Franean1_6571
  Lipid metabolism
   00071 Fatty acid degradation
    Franean1_6571
  Amino acid metabolism
   00350 Tyrosine metabolism
    Franean1_6571
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Franean1_6571
   00626 Naphthalene degradation
    Franean1_6571
Enzymes [BR:fre01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Franean1_6571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ABW15908
RhizoBase: Franean1_6571
UniProt: A8KYB8
Position
complement(7995180..7996256)
Genome map
AA seq 358 aa AA seqDB search
MLAWQVTRPAPVATAPLRAVELPIPEPGPGQVRLKVAACGVCRTDLHLAEGDLPPHRPLT
VPGHEVVGYVDALGPGVHGVSGPAGPAGAAGSRRPDPAPAAPIRLGDRLGIAWLAGTDQT
CAYCRRGAENLCPASLYTGWDADGGYAQYAVVDADYAYRLPAGYSDGELAPLLCAGIVGY
RALLRAELPPGGRLGVYGFGASAHLAAQVAIAQGATVHVMTRSARARRLALELGAASATG
AYDFPPEPLDGAVLFAPVGDLVPVALAALDRGGTLSIAGIHLTDVPVLNYRRHLFQERSV
RSTTANTRADGREFLEIAGRHRLAVTTTPYPLTAADQALEDLARDRVDGAAVLFPDGV
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgttggcctggcaggtcactcgccccgcgccggtggccacggcgccactgcgcgcggtc
gagctgcccatccccgagcccggtcccggtcaggtccgtctgaaggtcgccgcctgcggc
gtctgccggacggacctgcacctggccgagggcgacctcccgccgcaccggccgctcacc
gtgcccggtcacgaggtcgtcgggtacgtcgacgcgctcggtcccggggtccacggggtt
tccgggccagccgggccagccggtgcggccggctcccggcgacccgatccggccccggcg
gccccgatccggctgggtgaccggctcggcatcgcctggctcgccggaacggatcagacg
tgcgcctactgccggcgcggcgccgagaacctctgccccgcgtcgctctacacaggctgg
gacgccgacggcgggtacgcccagtacgccgtcgtcgacgcggactacgcctaccgcctg
cccgccggctacagcgacggcgagctggccccgttgctgtgcgccgggatcgtcggctac
cgggcgctgctgcgcgccgagcttccgcccggcggccggctgggcgtctacgggttcggc
gcgtccgcgcatctcgccgcgcaggtggcgatcgcccagggcgcgacggtgcacgtcatg
accaggtccgcccgggcccgccgcctcgccctcgagctcggcgcggcgtccgcgaccggc
gcctacgacttcccacccgagccgctcgacggggcggtcctgttcgcaccggtcggcgat
ctggtcccggtcgcgctcgccgcgctggacaggggcggcaccctctcgatcgccgggatc
cacctcaccgacgtcccggtcctgaactaccgtcggcacctgttccaggagcgctcggtg
cgcagcacgaccgcgaacacccgcgccgacggccgcgagttcctggagatcgccgggcgc
caccggctcgcggtgacaaccaccccgtacccgctgacggccgccgaccaggcgctcgag
gacctcgcacgcgaccgggtggacggcgccgccgtgctgttcccggacggcgtctga

DBGET integrated database retrieval system