KEGG   Frankia sp. EAN1pec: Franean1_6757Help
Entry
Franean1_6757     CDS       T00608                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
fre  Frankia sp. EAN1pec
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(8218955..8220208)
Genome map
AA seq 417 aa AA seqDB search
MSVGTMSSESERFRHAMVDQFVADQAAEGCSPRPEVEAAMRAVPRELFTPGLPLEQAYEN
EAVLKKMRGDEAISSVSAPFLIGRMLGQAADALDGLDGRHVLEIGSGGYNASLLRELVGS
SGSVTTVDIDPEVTDRAVSCLAAAGYDDVTVVCADAEHPIAPGRRWDLIIVTVGAWDIPP
AWRDQLTDGGVLVVPLRTFGMTRSWALRRREGRLVSVSQRLCGFVSMQGAGASEVRYADI
ADGVHLRLDEGQHVDSAAVADLLTTPREQVWAEVSLPPRTDLSDLDLWLATRPQVEAEQF
VVLAAQEEAVTAGIVTPSWRFAVPATLAAGTLAYRSALRWTDRRFDLGACAHGTGAAAAA
GRMVEHMRAWVDAGCPPPVLHILPAHTPDGDVPEGAVLDKRHSRLVLTFTTEKKGTT
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcggcaccatgagtagcgagagtgagcgcttccgtcacgcgatggtcgaccag
ttcgttgccgatcaggcggcggaaggctgctcgccgcgcccggaagtggaggcggcgatg
cgggctgttcctcgtgagctgttcacgccgggccttccgctggaacaggcgtatgagaac
gaagctgtcctgaagaagatgcgcggggacgaagcgatcagttcggtgtcggccccgttc
ctgatcgggcggatgctgggtcaggcggcagacgcgctcgatgggctggatggccggcac
gtgctggagatcggcagcggtggctacaacgcctcgctgctgcgggaactcgtcggctcg
tcaggatcggtcacgacggtcgacatcgaccccgaggtgaccgaccgggcggtttcctgc
ctggcagcggccggctacgacgacgtcaccgtggtctgcgcggacgccgaacacccgatc
gcgcccggccgccgctgggatttgatcattgtcacggtcggggcgtgggacatcccgccg
gcgtggcgtgatcagctcaccgacgggggcgtgctggtggtgccgctgcgtacgttcggg
atgactcggtcgtgggcgttgcggcgccgcgagggccgcctggtcagcgtgagccagcgg
ttgtgcgggttcgtctcgatgcagggcgccggcgccagcgaggtgcgctacgccgacatc
gcggacggtgtgcacctgcggctggatgagggtcaacacgtcgattcggccgcggtcgct
gatctcctcacgacgccacgcgagcaggtgtgggccgaggtgagcctgccgccccgcacc
gatctgtccgacctcgacctgtggctggcgactcgaccgcaggtcgaggcggagcagttc
gtcgtcctcgccgcgcaggaggaagcggtcacggccggcatcgtcacgccctcgtggcgg
ttcgccgtcccggccacgctggcggccggcacgctggcctaccggtcggcgctgcgctgg
accgaccggcggttcgatctcggcgcatgtgcccacgggactggggccgccgcggcggcc
gggcggatggtcgagcacatgcgtgcgtgggtggatgcgggctgcccgcctccggtgctg
cacatcctgcccgcgcacacccccgatggcgacgtgccggagggggcggtcctggacaag
cggcacagccgcctcgtcctgaccttcaccacagagaagaagggaaccacctga

DBGET integrated database retrieval system