KEGG   Frankia sp. EAN1pec: Franean1_6931Help
Entry
Franean1_6931     CDS       T00608                                 

Definition
putative phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
fre  Frankia sp. EAN1pec
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Franean1_6931
Enzymes [BR:fre01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Franean1_6931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
8441355..8443790
Genome map
AA seq 811 aa AA seqDB search
MTAPAVHDQEQGDQEQGGLEHGLDEAQLDGLIAYWNAANYLTAAQIYLMDNPLLRRPLRR
DDIKPRLLGHWGTSPALNLVYAHLNRLVRRTGQDVLYVAGPGHGGPALVANTYLEGTYSE
IYPSVSRDVAGLTQLVRRFSTPGGIPSHVSVPTPGSIHEGGELGYALVHAFGAVFDHPDL
LVAAVVGDGEAETGPLEGSWKGVDFLNPSRDGAVLPILNLNEYKIANPTVLGRLSRERLN
HLFAGHGYDVLWVEGDDVRAVHRAFSAALTTAHSRIRDIQRTARRPGATVTEAPIWPMIV
LRTPKGWTGPHEVDGVLVEGTFRAHQVPLSGVRDNPEHLAQLEAWLRSYQPERLFDADGR
LVPELAALAPDGPARLGATSYANGGVRTEPLRLRDWRAHALDVDPARRGSLVHETTRPLG
ELLADVYRDNPTTFRVFSPDELASNRLGAILDVTDRCLVAPIDPRDDRVSPAGRAMEVLS
EHLCEGWLEGYTLTGRHGLFATYEAFAMVSASMVIQHTKWLQEASRLAWRAPVPSLNVLL
TSTCWRNDHNGFSHQGPGLIDTVVPLSPGVARIWLPPDANSLLSVADHCLRSRDHVNLLV
ADKQPHLQYLTADEAAEHAARGGSVWDWAGTETDLDREPDVVLAGIGDVPTLEILAAADL
LRRYVPSLAVRVVNIIDLMALLRSDLHPHGFSTPMFRALFTDSTDVVVGFHGYSRAVHQL
LHGRANPQRFHVRGFTEQGTTTTPFDMVVRNGLSRYHLAQLAVEFTRTTRPGTDRLVSHC
QDQLTRHDAHVTEHFEDLPEIREWTWPGRDT
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccccggccgtccacgaccaggaacaaggcgaccaggaacaaggcggcctggag
cacgggctcgacgaggcccagctggacgggctgatcgcctactggaacgcggcgaactac
ctgaccgcggcgcagatctacctgatggacaacccgctgctgcgccggccgctgcgccgc
gacgacatcaagccgcggctgctgggccactgggggacgtccccggcgctgaatctggtc
tacgcccacctgaaccggctggtccgccggaccggccaggatgtgctctacgtggccggc
cccgggcacggcgggccggcgctggtcgccaacacctacctggagggcacgtactcggag
atctacccgagcgtgtcgcgggacgtcgccgggctgacccagctcgtgcggaggttctcg
acccccggtggtatcccgagccatgtcagcgtcccgacgccggggtcgatccacgaaggc
ggcgagctcggctacgcgctcgtccacgcgttcggcgccgtgttcgaccaccccgatctg
ctggtcgccgccgttgtcggcgacggcgaggccgagaccggcccgctggagggcagctgg
aagggcgtcgacttcctcaacccgtcccgcgacggcgcggtgctgccgatcctcaacctc
aacgagtacaagattgccaacccgacggtgctcggccggctctcccgggaacggctgaac
cacctgttcgccggccacgggtacgacgtcctgtgggtggagggggacgacgtccgcgcg
gtgcaccgtgcgttcagcgccgcgctcaccacagcacacagccgcatccgcgacatccag
cggacggcccgacgtccaggtgccaccgtcaccgaggcgccgatctggccgatgatcgtg
ctgcggacccctaagggctggaccggcccgcacgaggtggacggcgtccttgtcgagggg
acgttccgagcgcaccaggtgccgctgtcgggggtgcgggacaatcccgagcatctcgcc
cagctcgaggcctggctgcgttcctaccagcccgagcggctgttcgacgccgacggccgg
ctggtccccgagctggcggcgctcgccccggacggcccggcccggctgggcgccacgagc
tacgccaacggcggcgtgcgcaccgagccgctgcggctgcgcgactggcgggcccacgcc
ctcgacgtcgacccggcccgccgcggcagcctcgtccacgagacgacccggccgctgggc
gagctgctggccgacgtctaccgggacaatccgaccaccttccgggtcttcagcccggac
gagctggccagcaaccgcctcggggcgatcctggacgtcaccgaccgctgcctggtcgcg
ccgatcgacccgcgcgacgaccgggtcagcccggccggccgggcgatggaggtcctctcc
gagcacctgtgcgagggctggctggagggctacaccctgaccggccggcacggcctgttc
gccacctacgaggcgttcgcgatggtgtcggcgtcgatggtgatccagcacaccaagtgg
ctccaggaggcgagccggctggcgtggcgcgcccccgtcccgagcctgaacgtcctgctg
accagcacctgctggcgcaacgaccacaacggcttctcccaccaggggccggggctcatc
gacacggtcgtgccgctctcgcccggggtcgcccggatctggctgccgccggacgcgaac
agcctgctctcggtcgccgaccactgcctgcgcagccgcgaccacgtcaacctgctcgtc
gccgacaaacagccgcacctgcagtacctgaccgccgacgaggccgccgagcacgccgcc
cgcggcgggtcggtctgggactgggccggcaccgagaccgacctcgaccgtgagcccgac
gtggtcctcgccgggatcggcgacgtgccgacactggagatcctcgcggccgcggacctg
ctccgccggtacgtgcccagcctggccgtccgggtcgtcaacatcatcgacctgatggcc
ctgctgcgctcggacctgcacccgcacgggttctccacgccgatgttccgcgcgctgttc
accgactcgacggacgtcgtcgtcggattccacggctacagccgggccgtccaccagttg
ctgcacggccgggcgaacccgcagcggttccacgtccgcgggttcaccgagcagggcacg
accacgacgccgttcgacatggtcgtccgcaacggcctgagccggtaccacctggcccag
ctcgccgtggagttcacccggaccacccgtcccggcaccgaccgcctggtcagccactgc
caggaccagctgacccgccacgacgcccacgtcaccgagcacttcgaggacctgcccgag
atccgggagtggacctggccgggccgcgatacctga

DBGET integrated database retrieval system