KEGG   Frankia sp. EAN1pec: Franean1_6969Help
Entry
Franean1_6969     CDS       T00608                                 

Definition
(GenBank) transcriptional regulator, IclR family
  KO
K13641  
IclR family transcriptional regulator, acetate operon repressor
Organism
fre  Frankia sp. EAN1pec
Brite
Transcription factors [BR:fre03000]
 Prokaryotic Type
  Helix-turn-helix
   IclR family
    Franean1_6969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(8493998..8494849)
Genome map
AA seq 283 aa AA seqDB search
MSTQAASPQGAATQAASPEVVSPEAGPPEAASSQGPAVPGVQSVHRALDLLEILAAAGGR
LPMAEVAARAQLPTPTVHRLLRTMVERGYLRQLPDRSYALGFRLVPLGARANAMVGANAS
GVLHDLVAELGETANLAVLSGDQAEYVAQAPSRYAMRMFTEVGRRVDLHSTGVGKALLAQ
LDDDEALGIIRSRGLPRYTAHTVGTETALRAELRRIRERGFALDEQEQEIGVRCVAIALD
PASAPGVAVSVSGPTARMTDELVERAVGLLQAAASRLAGDLRD
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaacacaggccgcgtcaccgcagggtgcggcaacacaggccgcgtcgccagaggtc
gtctcgccggaggccggcccgccagaggccgcctcgtcacaggggccggccgtgcccggg
gtgcagtcggtgcaccgtgcgttggacctgctcgagatcctcgcggcggccggcggccgg
cttcccatggccgaggtcgcggcgcgcgcgcagctgccgacgccgaccgtgcaccggctg
ctgcgcaccatggtcgagcgcgggtacctgcggcagctgcccgaccgcagctacgcgctc
ggcttccggctcgttccgctgggcgcccgcgcgaacgcgatggtcggcgccaacgcgtcc
ggtgtgctgcacgacctcgtcgccgagctgggcgagacggccaacctggccgtgctctcc
ggcgaccaggccgagtacgtcgcccaggcgccgtcgcggtatgcgatgcgcatgttcacc
gaggtcgggcggcgggtcgacctgcactcgaccggcgtgggcaaggcactgctcgcacag
ctggacgacgacgaggcgctcgggatcatccgcagccgcgggctgccgcggtacacggcg
cacacggtgggcaccgagacggcgctgcgcgcggagctgcgccgcatccgcgagcggggt
ttcgcgctcgacgagcaggagcaggagatcggcgtgcgctgcgtggccatcgccctcgac
ccggcgagcgcgccgggggtcgcggtctcggtgtccgggccgacggcgcggatgaccgac
gagctggtcgagcgcgcggtcgggctgctgcaggcggcggcgtcccggctggccggagac
ctgcgggactga

DBGET integrated database retrieval system