KEGG   Frankia sp. EAN1pec: Franean1_6970Help
Entry
Franean1_6970     CDS       T00608                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
fre  Frankia sp. EAN1pec
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:fre01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:fre00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:fre00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
8494921..8497098
Genome map
AA seq 725 aa AA seqDB search
MPDYIDVVGLRVASELHQFVAEEALPGSGVDQAAFWAGATEIINDLTPRNRELLARRDEL
QQAVDDYHRRTPGRPAQSDYAEFLTSIGYLLDEPAPFTITTDGVDDEIATQAGPQLVVPL
LNARYAVNAANARWGSLYDALYGSDVIDETDGRERAGGYNPTRGAAVIARVREILDRSFP
LTSGSHADATRYAVDADGLVVTVDGAAVRLADPALFVGFRGEGDEPTAVLLTHHGLHVEI
QVDRNHPVGAGDRAGVSDVVVEAAVTTIMDLEDSVAAVDAADKVLGYRNWLQLMQRRLTA
EVDKGGRTFTRVLAADREYTTADGGTVTLPGRSMLLIRQVGLLMTTDAVLDRDGRPVPEG
ILDALVTGLGSVHDLRGDTAGGNSRTGSAYVVKPKMHGPDEVAFTVELMSRVERLLQLPP
ATIKLGIMDEERRTSVNLRRCVYEARDRVVFINTGFLDRTGDEIHTSMLAGPMVRKAAMR
EATWIRVYEDNNVDAGLALGFPGRAQIGKGMWAAPDNLADMMTQKIGHPLAGASCAWVPS
PTAAALHALHYHEVSVADRQRELAGRRPADRLELLTVPLAEPAAAWSPEEVAAEVDNNVQ
GVLGYVVRWVELGIGCSKVPDLTGTPLMEDRATCRISSQHVANWLRHGIVSREQVEESLR
RMAALVDAQNAGEPGYRPMAPAFEELAFAAARALLLEGADQPNGYTEPLLHEHRRAQKNK
EMVRS
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgactacatcgacgtcgtcggactgcgcgtcgccagcgagctgcaccagttcgtc
gccgaggaggcgctgcccgggtcgggtgtcgaccaggccgcgttctgggccggcgccacg
gagatcatcaacgatctgaccccgcgcaaccgggagctactggcgcggcgcgacgagctc
cagcaggctgtggacgactaccaccggcgcacgccgggccggccggcgcagagcgactac
gccgagttcctgacctccatcggctacctgctcgacgagcccgcgccgttcaccatcacc
accgacggcgtggacgacgagatcgcgacccaggccggcccgcagctggtggtgccgctg
ctcaacgcgcggtacgcggtcaacgccgccaacgcccggtggggctcgctctacgacgcc
ctgtacggcagcgacgtcatcgacgagacagacggcagggagcgcgccggcggctacaac
ccgacccgcggcgccgcggtcatcgcccgggtccgggagatcctcgaccggagcttcccg
ctgaccagcggctcgcacgcggacgcgacccggtacgcggtcgacgccgacgggctcgtc
gtcaccgtcgacggggccgccgtccggctggccgaccccgcgctgttcgtcggcttccgc
ggcgagggcgacgagccgacggctgtcctgctgacccatcacgggctgcacgtcgagatc
caggtcgaccggaaccacccggtcggggcgggcgaccgcgcgggcgtcagcgacgtcgtc
gtcgaggccgccgtcaccacgatcatggacctggaggactcggtcgcggccgtcgacgcc
gcggacaaggtgctcggctaccgcaactggctgcagctcatgcagcgccggctcaccgcc
gaggtggacaagggcggccgcaccttcacccgggtcctcgccgccgaccgcgagtacacg
accgccgacggcggcacagtcaccctgcccggccggtcgatgttgctcatccgccaggtc
gggctgctgatgaccaccgatgcggtcctcgaccgcgacggccggccggtgcccgagggc
atcctcgacgcgctggtcaccggcctgggcagcgtgcatgacctgcgcggcgacaccgcc
ggcggcaactcccgcaccggctcggcgtacgtggtcaagcccaagatgcacggcccggac
gaggtcgccttcaccgtcgagctgatgtcccgcgtcgagcgcctcctccagctcccgccg
gcgacgatcaagctcggcatcatggacgaggaacgccgcacctcggtcaacctcaggcgc
tgcgtgtacgaggcccgggaccgcgtcgtcttcatcaacaccgggttcctggaccggacc
ggcgacgagatccacacctcgatgctcgccgggccgatggtccgcaaggccgccatgcgc
gaggcgacgtggatccgcgtctacgaggacaacaacgtcgacgccggcctcgccctcggt
ttccccgggcgggcgcagatcggcaagggcatgtgggccgcgccggacaatctggccgac
atgatgacgcagaagatcgggcacccgctggccggcgcgtcctgcgcctgggtgccctcg
cctaccgccgcggcgctgcacgcactgcactaccacgaggtctccgtggcggaccggcag
cgcgagctggccggccgccgcccggccgaccggctggagctgctcaccgtcccgctcgcg
gaaccggcggccgcctggtcgccggaggaggtcgccgccgaggttgacaacaacgtccag
ggcgtgctcggctacgtcgtgcgctgggtcgagctcggcatcggctgctccaaggtgccc
gacctgaccggcacacccctgatggaggaccgcgccacctgccgcatctcctcccagcac
gtggccaactggctgcggcacggcatcgtctcccgcgagcaggtcgaggagtcgctgcgc
cggatggccgcgctcgtcgacgcgcagaacgccggcgagccggggtaccggccgatggcc
ccggccttcgaggagctggccttcgccgccgcgcgggcgctgctactcgagggcgccgac
cagccgaacggctacaccgaaccgctgttgcacgagcaccggcgcgctcagaagaacaag
gagatggtccgctcatga

DBGET integrated database retrieval system